BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D04 (216 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000E495DA Cluster: PREDICTED: hypothetical protein,... 33 1.3 >UniRef50_UPI0000E495DA Cluster: PREDICTED: hypothetical protein, partial; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein, partial - Strongylocentrotus purpuratus Length = 909 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 141 ILHCTTHIKDRRTTNKTGATFIFTKLIVYIE*VMRFSERS 22 IL CT HIK RR + K G T + +V +E +ERS Sbjct: 629 ILQCTVHIKARRVSWKKGTTSSANESLVVMESTKHVAERS 668 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,067,963 Number of Sequences: 1657284 Number of extensions: 2814339 Number of successful extensions: 5598 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5597 length of database: 575,637,011 effective HSP length: 50 effective length of database: 492,772,811 effective search space used: 10348229031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -