BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D04 (216 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0446 - 17221514-17221626,17221960-17222035,17222381-172225... 26 3.6 07_03_0940 + 22762176-22762345,22763207-22763252 25 8.3 02_05_0361 + 28285994-28286063,28286341-28286393,28286528-282865... 25 8.3 >08_02_0446 - 17221514-17221626,17221960-17222035,17222381-17222536, 17222645-17222723,17223858-17224087,17224938-17225076, 17225158-17225220,17226198-17226279,17226366-17226444, 17227046-17227225,17227331-17227590,17227704-17227806, 17227915-17228058,17228148-17228246 Length = 600 Score = 26.2 bits (55), Expect = 3.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 158 SLTYNKSYIARHTLRIEEQQTKLVQPSFL 72 S++YN Y+ T RIE+++ K P FL Sbjct: 159 SISYNNRYVQSETFRIEKERQK---PCFL 184 >07_03_0940 + 22762176-22762345,22763207-22763252 Length = 71 Score = 25.0 bits (52), Expect = 8.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 79 EGCTSFVCCSSILNVC 126 EGC + +CC +L++C Sbjct: 55 EGCCAALCCCCLLDMC 70 >02_05_0361 + 28285994-28286063,28286341-28286393,28286528-28286588, 28286825-28287912 Length = 423 Score = 25.0 bits (52), Expect = 8.3 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 41 ITHSIYTINFVKMKVAPVLFVVLLSLMCVVQCKIYCRSSF-ITTNM 175 I+H Y + F+ A + ++LSLM V K+ R +F + NM Sbjct: 246 ISHGKYILGFLLTLGASATYSLILSLMQVTFEKVIKRETFSVVLNM 291 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,919,281 Number of Sequences: 37544 Number of extensions: 70099 Number of successful extensions: 115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 14,793,348 effective HSP length: 51 effective length of database: 12,878,604 effective search space used: 257572080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -