BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D04 (216 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 21 6.9 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 21 6.9 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 20.6 bits (41), Expect = 6.9 Identities = 7/32 (21%), Positives = 19/32 (59%) Frame = +2 Query: 44 THSIYTINFVKMKVAPVLFVVLLSLMCVVQCK 139 T ++YT+N +K + + +++ ++ +CK Sbjct: 747 TETVYTLNDIKRYLVHAIENLIVVIVIYDKCK 778 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 143 KSYIARHTLRIEEQQTKLVQPSFL 72 KSYI RH ++E T S L Sbjct: 83 KSYITRHEGALQEHFTSRTARSLL 106 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,975 Number of Sequences: 2352 Number of extensions: 3159 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 49 effective length of database: 448,731 effective search space used: 9872082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -