BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D04 (216 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF061324-1|AAC16058.1| 1549|Homo sapiens sulfonylurea receptor 2... 28 6.2 AF061323-1|AAC16057.1| 1549|Homo sapiens sulfonylurea receptor 2... 28 6.2 >AF061324-1|AAC16058.1| 1549|Homo sapiens sulfonylurea receptor 2B protein. Length = 1549 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 47 HSIYTINFVKMKVAPVLFVVLLSLMCVVQCKIYCRSSFITTNM 175 H+I T NF K+ +A L+ V+ + ++ YC+S +N+ Sbjct: 123 HNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNL 165 >AF061323-1|AAC16057.1| 1549|Homo sapiens sulfonylurea receptor 2A protein. Length = 1549 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 47 HSIYTINFVKMKVAPVLFVVLLSLMCVVQCKIYCRSSFITTNM 175 H+I T NF K+ +A L+ V+ + ++ YC+S +N+ Sbjct: 123 HNIETSNFPKLLLALFLYWVMAFITKTIKLVKYCQSGLDISNL 165 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,896,178 Number of Sequences: 237096 Number of extensions: 414622 Number of successful extensions: 683 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 76,859,062 effective HSP length: 50 effective length of database: 65,004,262 effective search space used: 1365089502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -