BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D03 (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 26 0.19 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 3.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.2 AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. 22 4.2 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 4.2 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 5.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 5.5 M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosec... 21 7.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.6 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 26.2 bits (55), Expect = 0.19 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 464 LFTVIRKTLIIDDMPMEYVHFIRGH 390 LFT + + I + MPME + +R H Sbjct: 322 LFTTVHRICIGETMPMELIENLRNH 346 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 3.2 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +3 Query: 342 SRHYLSLSKILKNIDAMAANKMNVLHWHIVDDQSFPYHSEKFPELSRLGAYHP 500 S H + LS ++ D + LH H V Q PY + P+ + HP Sbjct: 52 STHLMDLSSPPEHRDLPIYQSHHHLHHHQVLYQQSPYLMYENPDEEKRYQEHP 104 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 260 VCKIEELRPSFQASYNAPYRCACHSSGRC 174 V K+E + + A P C CH+ RC Sbjct: 459 VYKVETVGDKYMAVSGLPEPCRCHA--RC 485 >AY082691-1|AAL92482.1| 77|Apis mellifera preprosecapin protein. Length = 77 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 252 LTNDFRELRINSTDIYDYPRY 314 ++ND + L S D+ PRY Sbjct: 33 VSNDMQPLEARSADLVPEPRY 53 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 4.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 260 VCKIEELRPSFQASYNAPYRCACHSSGRC 174 V K+E + + A P C CH+ RC Sbjct: 459 VYKVETVGDKYMAVSGLPEPCRCHA--RC 485 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 323 GTPAGHIQALFIVIEDTKEYRC 388 G H+ +++ED EY C Sbjct: 478 GDVISHVNISHVMVEDGGEYSC 499 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = +2 Query: 323 GTPAGHIQALFIVIEDTKEYRC 388 G H+ +++ED EY C Sbjct: 478 GDVISHVNISHVMVEDGGEYSC 499 >M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosecapin mRNA, complete cds. ). Length = 77 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 252 LTNDFRELRINSTDIYDYPRY 314 ++ND + L S D+ PRY Sbjct: 33 VSNDRQSLEARSADLVPEPRY 53 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 81 QGTVQELHVELTAPCEKLP 137 Q T +LH+ LT+P + P Sbjct: 665 QHTQSQLHLHLTSPPARSP 683 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,413 Number of Sequences: 438 Number of extensions: 2417 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -