BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_D02 (102 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49858| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-05 SB_33855| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_49858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 927 Score = 43.2 bits (97), Expect = 3e-05 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +1 Query: 1 GEPNLQSTAHQLGLPPGRIIFSNVAAKEEHVRRG 102 GE N+++ +GL R+IFS VA KEEHVRRG Sbjct: 820 GESNIKAEVSSMGLSQDRVIFSPVAPKEEHVRRG 853 >SB_33855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 25.0 bits (52), Expect = 9.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 22 TAHQLGLPPGRIIFSNVAAKEEHVRRG 102 T H G P R F+ VAA E R G Sbjct: 329 TCHAEGFPGSRHTFTVVAATSEQTRNG 355 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.135 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,111,093 Number of Sequences: 59808 Number of extensions: 43236 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 16,821,457 effective HSP length: 14 effective length of database: 15,984,145 effective search space used: 303698755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -