BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C24 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13800.2 68418.m01610 hydrolase, alpha/beta fold family prote... 29 1.4 At5g13800.1 68418.m01609 hydrolase, alpha/beta fold family prote... 29 1.4 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 29 1.4 At1g31630.1 68414.m03884 MADS-box family protein similar to MADS... 29 1.4 At5g09640.1 68418.m01115 sinapoylglucose:choline sinapoyltransfe... 28 4.4 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 28 4.4 At1g65270.3 68414.m07401 expressed protein 27 5.8 At1g65270.2 68414.m07400 expressed protein 27 5.8 At1g65270.1 68414.m07399 expressed protein 27 5.8 At1g43780.1 68414.m05043 serine carboxypeptidase S10 family prot... 27 5.8 >At5g13800.2 68418.m01610 hydrolase, alpha/beta fold family protein low similarity to hydrolase [Terrabacter sp. DBF63] GI:14196240; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 484 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 90 PTVGPVTMRAKRSA--DDEPLWLFKDNNEPRA 179 PT P TM + S+ D EP W F D EP A Sbjct: 158 PTEDPTTMTEETSSSEDKEPFWGFGDKTEPWA 189 >At5g13800.1 68418.m01609 hydrolase, alpha/beta fold family protein low similarity to hydrolase [Terrabacter sp. DBF63] GI:14196240; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 484 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 90 PTVGPVTMRAKRSA--DDEPLWLFKDNNEPRA 179 PT P TM + S+ D EP W F D EP A Sbjct: 158 PTEDPTTMTEETSSSEDKEPFWGFGDKTEPWA 189 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +3 Query: 159 DNNEPRAPSTGDHPVLPSIIDDIKLNPN-TR----YARSLSTPNKYHGGS 293 DNN P +P P ID ++L+PN TR YA +ST + + G+ Sbjct: 595 DNNLPSSPLFTKGITAPGNIDSLRLSPNFTRRFSTYAERISTTSSFSDGA 644 >At1g31630.1 68414.m03884 MADS-box family protein similar to MADS-box protein NMH 7 GI:2827300 from [Medicago sativa] Length = 339 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 153 FKDNNEPRAPSTGDHPVLPSIIDDIKLNPNTRY 251 F DN + +AP +H + I D++ L+PN +Y Sbjct: 239 FSDNIQYQAPVDFNHQIQHGIYDNLSLDPNHQY 271 >At5g09640.1 68418.m01115 sinapoylglucose:choline sinapoyltransferase (SNG2) GC donor splice site at exon 11 and 13; TA donor splice site at exon 10; similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa]; wound-inducible carboxypeptidase, Lycopersicon esculentum, EMBL:AF242849; contains Pfam profile PF00450: Serine carboxypeptidase; identical to cDNA sinapoylglucose:choline sinapoyltransferase (SNG2) GI:15418806 Length = 465 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 406 RRLVVARTPANSSRLQPP*CLVYEYFIS 489 RR++ + +SS L PP C Y YF+S Sbjct: 301 RRVMKEFSVNDSSSLPPPSCFTYRYFLS 328 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 27.9 bits (59), Expect = 4.4 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 4/63 (6%) Frame = +3 Query: 171 PRAPSTGDHPVLPSII-DDIKLNPNTRYARS---LSTPNKYHGGSHTISKSSQSTGPTHP 338 P +PS G P PS K +P+ Y+ S LS + Y S S +S S PT P Sbjct: 1715 PTSPSYG--PTSPSYNPQSAKYSPSIAYSPSNARLSPASPYSPTSPNYSPTSPSYSPTSP 1772 Query: 339 GYN 347 Y+ Sbjct: 1773 SYS 1775 >At1g65270.3 68414.m07401 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 246 RYARSLSTPNKYHGGSHTISKSSQSTGPT 332 +Y R L P K+ SHTI KSS+ T Sbjct: 193 QYPRQLKLPAKWSFNSHTILKSSEQAPRT 221 >At1g65270.2 68414.m07400 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 246 RYARSLSTPNKYHGGSHTISKSSQSTGPT 332 +Y R L P K+ SHTI KSS+ T Sbjct: 193 QYPRQLKLPAKWSFNSHTILKSSEQAPRT 221 >At1g65270.1 68414.m07399 expressed protein Length = 292 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 246 RYARSLSTPNKYHGGSHTISKSSQSTGPT 332 +Y R L P K+ SHTI KSS+ T Sbjct: 193 QYPRQLKLPAKWSFNSHTILKSSEQAPRT 221 >At1g43780.1 68414.m05043 serine carboxypeptidase S10 family protein similar to serine carboxylase II-3 GB:CAA55478 GI:474392 from [Hordeum vulgare] Length = 479 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +3 Query: 141 PLWLFKDNNEPRAPSTGDHPVLPSIIDDIKLNPNTRY 251 P+W+F + + P G ++ + DD+ N Y Sbjct: 380 PVWVFSGDEDSVIPLLGSRTLVKELADDLNFNTTVPY 416 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,940,337 Number of Sequences: 28952 Number of extensions: 218717 Number of successful extensions: 571 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -