BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C16 (587 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0942 - 29551856-29552344,29552569-29552934,29553985-29554203 29 2.7 10_07_0193 - 13954819-13954950,13955340-13955375 29 3.6 05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090,277... 29 3.6 05_07_0291 - 29020032-29020660,29020747-29020817,29021020-290211... 28 6.3 11_01_0104 - 781471-781888,781994-782101,782195-782511 27 8.4 05_04_0032 + 17363039-17363436,17363626-17363936,17364058-173641... 27 8.4 04_04_1249 - 32067644-32067787,32068245-32068346,32068415-320684... 27 8.4 02_05_0935 - 32859353-32859360,32859476-32860438,32860535-32860757 27 8.4 01_06_0905 + 32880368-32880633,32882439-32882568,32882704-328828... 27 8.4 >04_04_0942 - 29551856-29552344,29552569-29552934,29553985-29554203 Length = 357 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = +1 Query: 385 KNILEKGFDTTGTGFKSIE--SWWYKSRLGFP 474 +NI GF+ + +SIE S+WY SRL +P Sbjct: 230 RNIANGGFNYVKSNERSIEFYSFWYSSRLRYP 261 >10_07_0193 - 13954819-13954950,13955340-13955375 Length = 55 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 515 GKPPRVPRGNRSLCGKPRRLLYH 447 G+ PR+PR LC P R +YH Sbjct: 19 GRLPRLPRHQEFLCFHPHRRVYH 41 >05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090, 2775176-2775319,2775485-2775767,2775874-2775929, 2776012-2776161,2776254-2776340,2776414-2776449, 2777100-2777162,2777247-2777327,2777407-2777496, 2777690-2777767,2777855-2778058,2778139-2778186, 2778262-2778447,2779879-2779978,2780121-2780260 Length = 744 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 23 LKRWSPLWMNMTWISRMHFTWTRLRCKRRSLI 118 +KRWS + + W+SR F R RRSLI Sbjct: 98 VKRWSNHKIMVRWLSRFFFYLDRYFISRRSLI 129 >05_07_0291 - 29020032-29020660,29020747-29020817,29021020-29021194, 29021451-29021571,29021686-29022036 Length = 448 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 581 DISIDGKTIPVLTGVTMTNIW 519 D S D +PV+ GVT+ N+W Sbjct: 360 DASYDPSKLPVVDGVTIKNVW 380 >11_01_0104 - 781471-781888,781994-782101,782195-782511 Length = 280 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +1 Query: 241 MGRLMSINDKRLDMLEIDSFVYKLDT---GKNNIVRSSLEMHGVIEQRPWTKNILEKGFD 411 +G ++S +DK + MLE+ KL GK + S++ H + E+ + + K + Sbjct: 51 LGDILSCSDKAISMLELGGDTKKLTNLVGGKRKGDKHSMDNHNLEEEAKESVSKRRKNAE 110 Query: 412 TTGT 423 TG+ Sbjct: 111 HTGS 114 >05_04_0032 + 17363039-17363436,17363626-17363936,17364058-17364120, 17364697-17365181,17365772-17366122 Length = 535 Score = 27.5 bits (58), Expect = 8.4 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 5/87 (5%) Frame = +1 Query: 100 QKKKSDMVYVARMRRLNHQPFKVSIDVMSDKAVD---AVVRIFIGPKYDCMGRLMSINDK 270 QK ++ M + R +HQ K ++ +D AVV G DC+ M ND Sbjct: 325 QKIQNQMTCCKKDGRRSHQKTKCMHTLLQKDDLDRSLAVVPPVFGRSTDCVLECMKKNDA 384 Query: 271 RLDMLEID--SFVYKLDTGKNNIVRSS 345 + D ++ D ++ GK+N + ++ Sbjct: 385 QEDAVQSDLNGITIEMFCGKDNFLTNA 411 >04_04_1249 - 32067644-32067787,32068245-32068346,32068415-32068438, 32068439-32068543,32068625-32068729,32068885-32068966, 32069254-32069456,32069534-32069692,32070045-32070154, 32070264-32070405,32070544-32070690,32070773-32070847, 32070923-32071132,32071223-32071426,32071514-32071633, 32071743-32071852,32072033-32072177,32072266-32072499, 32072611-32072646 Length = 818 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 422 VPVVSKPFSNMFLVHGLCSITPCISSELRTMLFLPVS 312 VP + + + V LC PC+ + +T++F+ +S Sbjct: 717 VPFRNSKLTYLLQVSDLCKWMPCLGGDSKTLMFVNIS 753 >02_05_0935 - 32859353-32859360,32859476-32860438,32860535-32860757 Length = 397 Score = 27.5 bits (58), Expect = 8.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -3 Query: 534 DDEHLERQTAEGSER*QKPVRKAKATLIPPTLDALETCSS 415 D ++ E+ G R +KPV + AT PP+ A S+ Sbjct: 113 DSKYCEKHMHRGKNRSRKPVEMSLATPPPPSSSATSAASN 152 >01_06_0905 + 32880368-32880633,32882439-32882568,32882704-32882894, 32883625-32883852,32884062-32884224,32884343-32884416, 32884484-32884601,32884722-32884788,32885152-32885223, 32885350-32885513 Length = 490 Score = 27.5 bits (58), Expect = 8.4 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 587 IVDISIDGKTIPVLTGVTMTNIWRGKPPR 501 +VD ++G P + G+ T + G PP+ Sbjct: 74 VVDFPVEGSANPFMVGLYFTRVKLGSPPK 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,235,475 Number of Sequences: 37544 Number of extensions: 304375 Number of successful extensions: 963 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -