BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C16 (587 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55210.1 68418.m06882 expressed protein similar to unknown pr... 30 1.3 At2g05645.1 68415.m00604 hypothetical protein 30 1.3 At4g34220.1 68417.m04862 leucine-rich repeat transmembrane prote... 29 1.7 At1g09090.2 68414.m01015 respiratory burst oxidase protein B (Rb... 29 1.7 At1g09090.1 68414.m01014 respiratory burst oxidase protein B (Rb... 29 1.7 At5g43190.1 68418.m05276 F-box family protein (FBX6) contains si... 28 4.0 At1g48690.1 68414.m05449 auxin-responsive GH3 family protein sim... 28 4.0 At1g08210.1 68414.m00907 aspartyl protease family protein contai... 28 4.0 At5g10710.2 68418.m01241 expressed protein 28 5.3 At5g10710.1 68418.m01240 expressed protein 28 5.3 At2g16950.1 68415.m01953 importin beta-2 subunit family protein ... 28 5.3 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 28 5.3 At1g50940.1 68414.m05727 electron transfer flavoprotein alpha su... 28 5.3 At4g29200.1 68417.m04177 hypothetical protein 27 7.0 At2g34210.1 68415.m04186 KOW domain-containing transcription fac... 27 7.0 At1g65180.1 68414.m07390 DC1 domain-containing protein contains ... 27 7.0 At1g50730.1 68414.m05705 expressed protein 27 7.0 At5g22850.1 68418.m02671 aspartyl protease family protein contai... 27 9.3 At3g01200.1 68416.m00026 expressed protein contains Pfam domain ... 27 9.3 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 27 9.3 >At5g55210.1 68418.m06882 expressed protein similar to unknown protein (pir||T04913) Length = 168 Score = 29.9 bits (64), Expect = 1.3 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 305 INSTLVRTTSSAARSRCTAL-SNRDRGLKTYWKKVSTQLEQVSRASRVGG 451 + S L RT+S + TA+ S R R K W +VST V RAS+ G Sbjct: 4 VGSRLSRTSSRYSGPAATAVFSGRVRKWKKKWVRVSTSSVGVFRASKSNG 53 >At2g05645.1 68415.m00604 hypothetical protein Length = 204 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -1 Query: 449 HQLSMLLKPVPVVSKPFSNMFLVHG 375 H+ +LL P P++S P S+MF+ HG Sbjct: 130 HRPFVLLMPRPLLSSPHSHMFVEHG 154 >At4g34220.1 68417.m04862 leucine-rich repeat transmembrane protein kinase, putative protein kinase TMKL1, Arabidopsis thaliana, PID:E353150 Length = 757 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/63 (31%), Positives = 33/63 (52%) Frame = -1 Query: 584 VDISIDGKTIPVLTGVTMTNIWRGKPPRVPRGNRSLCGKPRRLLYHQLSMLLKPVPVVSK 405 VD+S + T P+ + +++ N + GN+ LCGKP ++L S L P P +S+ Sbjct: 249 VDLSFNNLTGPIPSSLSLLN----QKAESFSGNQELCGKPLKILCSIPSTLSNP-PNISE 303 Query: 404 PFS 396 S Sbjct: 304 TTS 306 >At1g09090.2 68414.m01015 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 843 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +2 Query: 8 LNALYLKRWSPLWMNMTWIS--RMHFTWTRLRCKRRSLIWSTLRVCGVLITSLSRCLSML 181 ++ +L+ W +W+ WIS FTW L+ KR++ ++ + C + + L Sbjct: 287 ISYFFLENWKRIWVLTLWISICITLFTWKFLQYKRKT-VFEVMGYCVTVAKGSAETLKFN 345 Query: 182 CQIRLLTQSFVYLLVPNTIAW 244 + LL + NTI W Sbjct: 346 MALILLP------VCRNTITW 360 >At1g09090.1 68414.m01014 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 622 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +2 Query: 8 LNALYLKRWSPLWMNMTWIS--RMHFTWTRLRCKRRSLIWSTLRVCGVLITSLSRCLSML 181 ++ +L+ W +W+ WIS FTW L+ KR++ ++ + C + + L Sbjct: 287 ISYFFLENWKRIWVLTLWISICITLFTWKFLQYKRKT-VFEVMGYCVTVAKGSAETLKFN 345 Query: 182 CQIRLLTQSFVYLLVPNTIAW 244 + LL + NTI W Sbjct: 346 MALILLP------VCRNTITW 360 >At5g43190.1 68418.m05276 F-box family protein (FBX6) contains similarity to unusual floral organs (UFO) GI:4376159 from [Arabidopsis thaliana] Length = 403 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 218 LLVPNTIAWAAS*ASMTNALTCSKSIASSINSTLVRTTSSAARS 349 L PN I+W + +LTC+ S+ SS N L + S ++ S Sbjct: 112 LFNPNLISWCTLPLPRSLSLTCASSLLSSSNGLLCFSLSPSSVS 155 >At1g48690.1 68414.m05449 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 190 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 428 KPVPVVSKPFSNMFLVHGLCSIT 360 K PV +K F NM +H LCS T Sbjct: 99 KIFPVNNKYFENMIFIHALCSST 121 >At1g08210.1 68414.m00907 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) {Nicotiana tabacum} Length = 492 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 Query: 587 IVDISIDGKTIPVLTGVTMTNIWRGKPPR 501 +V+ +DG + P L G+ T + G PPR Sbjct: 67 VVNFPVDGASDPFLVGLYYTKVKLGTPPR 95 >At5g10710.2 68418.m01241 expressed protein Length = 312 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = -3 Query: 327 VLTSVEFIDEAIDFEHVKAFVIDAHEAAHAIVFGTNKYTNDCVNSLI*HNIDRHLERLVI 148 VL S F+++ I EH F + + + ++F K D V L+ +DR + +I Sbjct: 142 VLESKSFLEKMIVLEHTIPFFLPLSDLENDLLFSNAKKFIDNVGDLLQAYVDRKEQVRLI 201 Query: 147 K 145 K Sbjct: 202 K 202 >At5g10710.1 68418.m01240 expressed protein Length = 312 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = -3 Query: 327 VLTSVEFIDEAIDFEHVKAFVIDAHEAAHAIVFGTNKYTNDCVNSLI*HNIDRHLERLVI 148 VL S F+++ I EH F + + + ++F K D V L+ +DR + +I Sbjct: 142 VLESKSFLEKMIVLEHTIPFFLPLSDLENDLLFSNAKKFIDNVGDLLQAYVDRKEQVRLI 201 Query: 147 K 145 K Sbjct: 202 K 202 >At2g16950.1 68415.m01953 importin beta-2 subunit family protein similar to SP|Q92973 Importin beta-2 subunit (Transportin) {Homo sapiens}; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 891 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 218 NIRTTASTALSDITSIDTLKGW 153 NIRTT T +S I +I+ + GW Sbjct: 109 NIRTTVGTIISVIVNIEGVSGW 130 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = -3 Query: 534 DDEHLERQTAEGSER*QKPVRKAKATLIPP-TLDALETCS---SCVETFFQYVFSPRSLF 367 DD +++ + + S ++PV K A+ P T D+L + + ++ F F P SLF Sbjct: 109 DDSYMDTSSEDESSSAEEPVNKPAASAAKPATKDSLFSAGFKPAAKDSLFSAGFKPDSLF 168 Query: 366 DNAVHLERAADDVVLTS 316 + E AA D + ++ Sbjct: 169 --SAGFEPAAKDSLFSA 183 >At1g50940.1 68414.m05727 electron transfer flavoprotein alpha subunit family protein contains Pfam profile: PF00766 electron transfer flavoprotein, alpha subunit Length = 363 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/85 (28%), Positives = 40/85 (47%) Frame = +2 Query: 89 RLRCKRRSLIWSTLRVCGVLITSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAAS*ASMT 268 R K + + + R + ITSLSRC+S L +L + + P T++ + S+ Sbjct: 8 RALTKNKFVASNAPRSISISITSLSRCISTL----ILAEHESGTIKPQTVSTVVAANSLG 63 Query: 269 NALTCSKSIASSINSTLVRTTSSAA 343 + + S +A S S+L S AA Sbjct: 64 ESSSISLLLAGS-GSSLQEAASQAA 87 >At4g29200.1 68417.m04177 hypothetical protein Length = 457 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = +2 Query: 116 IWSTLRVCGVLITSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAAS*ASMTNALTCSKSI 295 I+ L C VL L CL L + + + F+++++ NT+ A N+++C+ S+ Sbjct: 399 IYCDLTCCTVL---LCLCLKALMEFKSMHFIFLFMVLGNTVCCNALIFEFLNSISCNCSM 455 >At2g34210.1 68415.m04186 KOW domain-containing transcription factor family protein Length = 990 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = +1 Query: 187 DKAVDAVVRIFIGPKYDCMGRLMSINDKRLDMLEIDSFVYKLDTGKNNIVRSSL 348 D V V+I +GP GRL+ + DK L +E+++ K+ TGK + R ++ Sbjct: 683 DHLVGTYVKIRLGPFKGYSGRLVEVKDK-LVRVELEA---KIVTGKLHFERKAI 732 >At1g65180.1 68414.m07390 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 515 GKPPRVPRGNRSLCGKP--RRLLYH 447 GKPP GN SLCGK + YH Sbjct: 186 GKPPAYTDGNCSLCGKKIFDEMFYH 210 >At1g50730.1 68414.m05705 expressed protein Length = 1013 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/80 (22%), Positives = 37/80 (46%) Frame = +2 Query: 107 RSLIWSTLRVCGVLITSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAAS*ASMTNALTCS 286 RS W+TLRV + ++ LS L Q L S ++ N + + + ++C+ Sbjct: 788 RSSSWATLRVKVKIFCAIMSLLSTLSQDNLPYHSANPEIIGNELLFFGDSSYKQELVSCT 847 Query: 287 KSIASSINSTLVRTTSSAAR 346 + + S + + + +S +R Sbjct: 848 QLVLSELLDAIEQESSQISR 867 >At5g22850.1 68418.m02671 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 493 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 587 IVDISIDGKTIPVLTGVTMTNIWRGKPPR 501 ++D +DG P + G+ T + G PPR Sbjct: 64 VIDFPVDGTFDPFVVGLYYTKLRLGTPPR 92 >At3g01200.1 68416.m00026 expressed protein contains Pfam domain PF03618: Domain of unknown function (DUF299) Length = 377 Score = 27.1 bits (57), Expect = 9.3 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Frame = +1 Query: 244 GRLMSINDKRLDMLEIDSFVYKLDTG--KNNIVRSSLEMHGVIE--QRPWTKNILEKGFD 411 GR+ ++ND +E F K D G N+ ++ + + GV + P + I +KG+ Sbjct: 202 GRVKTLNDAYFKRIEAIEFTIKQDDGTLPENLSKADIVLVGVSRTGKTPLSTYIAQKGYK 261 Query: 412 TTGTGF 429 F Sbjct: 262 VANVPF 267 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 27.1 bits (57), Expect = 9.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 587 IVDISIDGKTIPVLTGVTMTNIWRGKPP 504 +VD + G + P L G+ T + G PP Sbjct: 83 VVDFPVQGSSDPYLVGLYFTKVKLGSPP 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,176,886 Number of Sequences: 28952 Number of extensions: 241525 Number of successful extensions: 746 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -