BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C14 (247 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 20 3.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 19 7.9 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.2 bits (40), Expect = 3.4 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 143 IYRRRKIYINHFLERALVDTQNRRVVYDSI 54 I R++K++IN L V+ + + YD + Sbjct: 553 INRKQKVFINGTLIIENVERASDQATYDCV 582 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 19.0 bits (37), Expect = 7.9 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -3 Query: 227 SQQGRHIDDYSTPSS 183 SQQ R++ +++ PS+ Sbjct: 27 SQQPRNVPNFAAPST 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,463 Number of Sequences: 336 Number of extensions: 895 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 46 effective length of database: 107,129 effective search space used: 3749515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.4 bits)
- SilkBase 1999-2023 -