BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C10 (610 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1159 - 9852316-9852441,9852743-9852838,9852912-9852977,985... 29 2.9 08_02_1550 - 27818271-27818618,27818743-27818955,27819079-278195... 27 8.8 04_01_0553 - 7128786-7128998,7129087-7129242,7129577-7130380 27 8.8 >06_01_1159 - 9852316-9852441,9852743-9852838,9852912-9852977, 9853091-9853180,9853262-9853373,9853515-9853598, 9853864-9853940,9854823-9854873,9854924-9855031, 9855703-9855774,9856952-9857011,9857808-9857876, 9858005-9858088,9858212-9858295,9859106-9859198, 9859930-9860030,9861155-9861264,9863058-9863104, 9863693-9863778,9863940-9864012,9864454-9864540, 9864650-9865301,9866164-9867182,9867702-9867797 Length = 1180 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = -1 Query: 316 IDTSTWHWYQPASFSCISLMDNVNVAVASSKRRENLESLMMSPALLDNGIDSNVFRRSYF 137 I T +HWYQ A C+ L V + + E L + A + D+ + S F Sbjct: 612 IRTDGFHWYQSARGQCVFLCSRVRGGIEEALACLACEQLSAAQATIIAAHDNRIVANSIF 671 >08_02_1550 - 27818271-27818618,27818743-27818955,27819079-27819597, 27820239-27820357,27820457-27820763,27820840-27820922, 27821027-27821204,27821328-27821401,27822078-27822293, 27822724-27822757 Length = 696 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/74 (22%), Positives = 29/74 (39%) Frame = +3 Query: 198 IKDSRFSLRFDDATATFTLSIKDIQENDAGWYQCQVLVSISSRITAEVELQVRRPPXISD 377 +K R S+ D AT S+ + + + S + E + + P +SD Sbjct: 44 LKFRRASIPEKDTDATNASSVSPVSSSSSWRRDSSCTKGEGSMDSQEPRVDAEQKPVLSD 103 Query: 378 NSTRSIVASEDESV 419 N + S+DE V Sbjct: 104 NPEEQTIPSKDEKV 117 >04_01_0553 - 7128786-7128998,7129087-7129242,7129577-7130380 Length = 390 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 198 IKDSRFSLRFDDATATFTLSIKDIQENDAGWYQ 296 I +RF FD T+T S+ +++E + W+Q Sbjct: 234 ISGTRFGSDFDKTTSTLIGSLINVRELNVSWFQ 266 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,221,638 Number of Sequences: 37544 Number of extensions: 412442 Number of successful extensions: 1124 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1124 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -