BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C09 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 32 0.48 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_55137| Best HMM Match : hATC (HMM E-Value=0.059) 31 1.1 SB_40860| Best HMM Match : MAAL_N (HMM E-Value=0.6) 31 1.1 SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) 29 4.4 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 29 4.4 SB_41210| Best HMM Match : MAAL_N (HMM E-Value=0.7) 28 7.7 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_6514| Best HMM Match : hATC (HMM E-Value=0.024) 28 7.7 SB_6223| Best HMM Match : Ras (HMM E-Value=0) 28 7.7 SB_48175| Best HMM Match : hATC (HMM E-Value=0.024) 28 7.7 SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) 28 7.7 SB_3583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 32.3 bits (70), Expect = 0.36 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = +1 Query: 196 ALDFYQTALRDPAFYQLYNRIVGYINAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFD 375 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 376 YSQ 384 Y Q Sbjct: 240 YGQ 242 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 31.9 bits (69), Expect = 0.48 Identities = 25/97 (25%), Positives = 42/97 (43%) Frame = +2 Query: 158 HLNHSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*SLILKRNFISSALKS 337 +L HST T S L T T +++++T + TLTH +IT S I L Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 338 MMLSLRN*SHSLTIANLMPLTVYS*PKKRLRLVTHTT 448 + L+ +HS + + + + +TH+T Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHSTITHST 121 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 236 SISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SHS-LTIANLMPLTV 403 ++++ T + +TLTHS++T + N S L L+ N +HS LT + L LT+ Sbjct: 1 TLTHPTLIHLTLTHSNLTHLTLTHSNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTL 57 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = +2 Query: 125 MKLSLAMCSVQHLNHSTSTPSCPVRLTFTKP---HFETLH-SISYITGLWVTLTHSSIT* 292 + L+ + + L H T T S LT T H H +++++T + TLTHS++T Sbjct: 40 LNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTHLTLTYSTLTHSTLTH 99 Query: 293 SLILKRNFISSALKSMMLSLRN*SHS 370 S + S L ++ +HS Sbjct: 100 STLTHSTLTHSTLTHSTITHSTLTHS 125 Score = 29.1 bits (62), Expect = 3.4 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 2/84 (2%) Frame = +2 Query: 122 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT*S 295 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 296 LILKRNFISSALKSMMLSLRN*SH 367 + S + L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 137 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 229 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_55137| Best HMM Match : hATC (HMM E-Value=0.059) Length = 619 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ M ++LT S +GQ I +K++++RI N+L Sbjct: 148 RSLLEKMGQRLTASAHLGQYITIVLKQEVERIKNEL 183 >SB_40860| Best HMM Match : MAAL_N (HMM E-Value=0.6) Length = 538 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ M ++LT S +GQ I +K++++RI N+L Sbjct: 148 RSLLEKMGQRLTASAHLGQYITIVLKQEVERIKNEL 183 >SB_43460| Best HMM Match : Keratin_B2 (HMM E-Value=0.68) Length = 306 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 148 LGAAPKPFDKHTFMPSALDFYQTALRDPAFYQLYNRIVGYINAF 279 +G + + F+P+ L F T+ D FY NR +G IN++ Sbjct: 1 MGVTLRRAKEKRFIPADLSFGITSFYDVYFYSPRNRSLGIINSY 44 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 540 DLDNGISGNIGLNVDGN 490 ++D G+SGN LNVDG+ Sbjct: 397 NIDTGVSGNFSLNVDGS 413 >SB_41210| Best HMM Match : MAAL_N (HMM E-Value=0.7) Length = 536 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 149 RSLLEKNGQRLTASAHLGQYISIVLKQEVERIKNEL 184 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 27.9 bits (59), Expect = 7.7 Identities = 27/104 (25%), Positives = 40/104 (38%) Frame = +1 Query: 268 INAFKHYLKPYPQEKLHFVGVKINDVVVEKLVTFFDYSQFDATNSVFLTKKEIKTSYPHN 447 + F+ L PYP ++HF VV + + D TNS F ++ P + Sbjct: 623 LTEFQTNLVPYP--RIHFPMASYAPVVSAEKAYHEQLTVADITNSCFEPANQMVKCDPRH 680 Query: 448 FKVRXPRLKHKPFSVTIDVXSDIATDAVIKIFLGPKYNDXGFPI 579 K L ++ V DV S IAT K + GF + Sbjct: 681 GKYMACCLLYRGDVVPKDVNSAIATIKTKKTIQFVDWCPTGFKV 724 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 492 RSLLEKNGQRLTASAHLGQYISIVLKQEVERIKNEL 527 >SB_6514| Best HMM Match : hATC (HMM E-Value=0.024) Length = 620 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 149 RSLLERNGQRLTASAHLGQYISIVLKQEVERIKNEL 184 >SB_6223| Best HMM Match : Ras (HMM E-Value=0) Length = 1665 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 1362 RSLLEKNGQRLTASAHLGQYISIVLKQEVERIKNEL 1397 >SB_48175| Best HMM Match : hATC (HMM E-Value=0.024) Length = 620 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 149 RSLLERNGQRLTASAHLGQYISIVLKQEVERIKNEL 184 >SB_7240| Best HMM Match : OMPdecase (HMM E-Value=0) Length = 474 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 313 LHFVGVKINDVVVEKLVTFFDYSQFDATNSV 405 LH G K++D VVE + F + +QF AT+ V Sbjct: 181 LHAQG-KVDDAVVESVREFLEANQFKATSDV 210 >SB_3583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 17 RKLISTMKRQLTLSETIGQRTPICMKKKLQRIINDL 124 R L+ ++LT S +GQ I +K++++RI N+L Sbjct: 148 RSLLEKNGQRLTASAHLGQYISIVLKQEVERIKNEL 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,698,102 Number of Sequences: 59808 Number of extensions: 390377 Number of successful extensions: 1042 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -