BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C04 (557 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 23 1.6 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 8.4 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 8.4 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 8.4 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 227 LQTALGYEYLRTPALHLDDGGQNLISKQRGFQFVNPTDDLVPR 355 ++T G E LR P+L ++ L+ F ++ D+L PR Sbjct: 390 VRTCNGLE-LRDPSLFVETSASELVESSVLFPSLDSRDELHPR 431 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 397 HQSQLCNSFFKSARPGNQVIGRVNELESTL 308 H +L N++FK + NEL+ L Sbjct: 39 HSDRLLNNYFKCLMDEGRCTAEGNELKRVL 68 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 397 HQSQLCNSFFKSARPGNQVIGRVNELESTL 308 H +L N++FK + NEL+ L Sbjct: 39 HSDRLLNNYFKCLMDEGRCTAEGNELKRVL 68 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 397 HQSQLCNSFFKSARPGNQVIGRVNELESTL 308 H +L N++FK + NEL+ L Sbjct: 39 HSDRLLNNYFKCLMDEGRCTAEGNELKRVL 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,356 Number of Sequences: 438 Number of extensions: 2939 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -