BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_C03 (517 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) cont... 140 4e-34 At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ... 136 1e-32 At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) cont... 132 1e-31 At5g36210.1 68418.m04365 expressed protein 29 1.4 At1g16370.1 68414.m01958 transporter-related low similarity to o... 27 7.5 At2g18870.1 68415.m02200 hypothetical protein contains 1 transme... 27 9.9 >At5g41520.1 68418.m05044 40S ribosomal protein S10 (RPS10B) contains similarity to 40S ribosomal protein S10 Length = 180 Score = 140 bits (340), Expect = 4e-34 Identities = 65/115 (56%), Positives = 85/115 (73%), Gaps = 1/115 (0%) Frame = +2 Query: 173 MLMPKQNRVSIYEYLFKEGVMVAKKDYHAPKHPDLEKIPNLQVIKAMQSLKSRGYVKEQF 352 M++ + NR I +YLFKEGV+ AKKD++ P+HP +E +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60 Query: 353 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGAVG-RPDAPAR 514 AW H+YW+LTNEGI++LR +L+LP EIVPATLK+ + G G RP P R Sbjct: 61 AWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKKQQKPLGRPFGGGGDRPRGPPR 115 >At4g25740.1 68417.m03706 40S ribosomal protein S10 (RPS10A) 40S ribosomal protein S10 - Lumbricus rubellus, PID:e1329701 Length = 177 Score = 136 bits (328), Expect = 1e-32 Identities = 59/97 (60%), Positives = 79/97 (81%) Frame = +2 Query: 173 MLMPKQNRVSIYEYLFKEGVMVAKKDYHAPKHPDLEKIPNLQVIKAMQSLKSRGYVKEQF 352 M++ + NR I +YLFKEGV AKKD++ PKHP ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISENNRREICKYLFKEGVCFAKKDFNLPKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 353 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR 463 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAK 96 >At5g52650.1 68418.m06536 40S ribosomal protein S10 (RPS10C) contains similarity to 40S ribosomal protein S10 Length = 179 Score = 132 bits (320), Expect = 1e-31 Identities = 58/97 (59%), Positives = 78/97 (80%) Frame = +2 Query: 173 MLMPKQNRVSIYEYLFKEGVMVAKKDYHAPKHPDLEKIPNLQVIKAMQSLKSRGYVKEQF 352 M++ + NR I +YLFKEGV AKKD++ KHP ++ +PNLQVIK MQS KS+ YV+E F Sbjct: 1 MIISEANRKEICKYLFKEGVCFAKKDFNLAKHPLID-VPNLQVIKLMQSFKSKEYVRETF 59 Query: 353 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVR 463 AW H+YW+LTNEGIE+LR +L+LP ++VPATLK+S + Sbjct: 60 AWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAK 96 >At5g36210.1 68418.m04365 expressed protein Length = 676 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 146 ILVFSWLS-KMLMPKQNRVSIYEYLFKEGVMVAKKDYHAPKH 268 I++F L K++ P Q+R IYE L K+G+ VA +Y +H Sbjct: 594 IILFQGLEDKVVTPDQSR-KIYEALKKKGLPVALVEYEGEQH 634 >At1g16370.1 68414.m01958 transporter-related low similarity to organic cation transporter OCTN1 from [Homo sapiens] GI:2605501, [Mus musculus] GI:4126605, [Rattus norvegicus] GI:5679326; contains Pfam profile PF00083: major facilitator superfamily protein Length = 521 Score = 27.1 bits (57), Expect = 7.5 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = +2 Query: 269 PDLEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHL 421 P IP + SL ++ + +WR+ Y Y + + Y IFL+L Sbjct: 210 PRATMIPFTLFVLGFMSLSGIAFLAQDSSWRYLYLYTSVPAVFYC-IFLYL 259 >At2g18870.1 68415.m02200 hypothetical protein contains 1 transmembrane domain; tandem duplication of fibronectin type III domain protein (GI:3004551) (TIGR_Ath1:At2g18880) [Arabidopsis thaliana] Length = 239 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +2 Query: 245 KDYHAPKHPDLEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWY 376 K A K+P+ + Q +K ++ L+ GYV+ F + W+ Sbjct: 129 KPEKAKKNPESYGLGLEQCVKIIRKLECSGYVESTFRQKFLTWF 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,845,307 Number of Sequences: 28952 Number of extensions: 215045 Number of successful extensions: 512 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -