BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B24 (214 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0500 + 3584743-3585516 30 0.29 11_04_0255 - 15422536-15422640,15422734-15422790,15422917-154230... 29 0.39 01_06_0246 + 27845898-27846001,27846235-27846237,27846472-278467... 29 0.68 02_05_0390 + 28557722-28557937,28558440-28558514,28558597-285587... 27 2.7 02_05_0391 + 28563242-28563302,28563714-28563931,28564563-285646... 26 4.8 06_03_0437 - 20765682-20765951,20766040-20766294,20766374-207665... 25 8.3 >06_01_0500 + 3584743-3585516 Length = 257 Score = 29.9 bits (64), Expect = 0.29 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 39 VGGRSKNXVDPPGLXGIRHEDCGH 110 +GG ++ VD PGL G R D GH Sbjct: 135 IGGGARGAVDAPGLIGDRFLDSGH 158 >11_04_0255 - 15422536-15422640,15422734-15422790,15422917-15423013, 15423155-15423222,15423299-15423344,15423467-15423621, 15423767-15423995,15424124-15424200,15425804-15425856, 15426082-15426139 Length = 314 Score = 29.5 bits (63), Expect = 0.39 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 120 AVFYFTIFYTLIIYFMSFYFL 182 AV YFT+F LI YFMSFY + Sbjct: 134 AVTYFTVFL-LINYFMSFYII 153 >01_06_0246 + 27845898-27846001,27846235-27846237,27846472-27846700, 27846814-27846968,27847091-27847136,27847233-27847324, 27847425-27847521,27847649-27847705,27847799-27847927 Length = 303 Score = 28.7 bits (61), Expect = 0.68 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 120 AVFYFTIFYTLIIYFMSFYFL 182 AV YFT+F LI YFMSFY + Sbjct: 107 AVPYFTVFL-LINYFMSFYII 126 >02_05_0390 + 28557722-28557937,28558440-28558514,28558597-28558766, 28559046-28559124,28559320-28559516,28560300-28560387, 28560453-28560679,28560763-28560919,28561467-28561517 Length = 419 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 118 QFTCPQSSCRIPCSPGGST*FLERPPTAXWSS 23 Q TCP ++CR P P L A W S Sbjct: 197 QLTCPDTNCRSPLPPSLLKSLLRDDGYAQWES 228 >02_05_0391 + 28563242-28563302,28563714-28563931,28564563-28564637, 28564730-28565264,28565343-28565523,28565586-28565724, 28565826-28566067,28566157-28566322,28566591-28566698 Length = 574 Score = 25.8 bits (54), Expect = 4.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 121 AQFTCPQSSCRIPCSP 74 A+ TCP +SCR P P Sbjct: 328 ARLTCPDTSCRRPLPP 343 >06_03_0437 - 20765682-20765951,20766040-20766294,20766374-20766545, 20766964-20767097,20767205-20767288,20767369-20767659, 20767867-20768214,20768321-20768496,20768579-20768695, 20768780-20768936,20769110-20769225,20769323-20769483, 20769567-20769883,20769969-20770250,20770347-20770648, 20771977-20772067,20773203-20773256,20773723-20773812 Length = 1138 Score = 25.0 bits (52), Expect = 8.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 123 VFYFTIFYTLIIYFMSFYFLLIIKKYLVFF 212 VF T +YTLI+Y M + K + FF Sbjct: 972 VFVQTAYYTLIVYAMMSFQWTAAKFFWFFF 1001 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,255,558 Number of Sequences: 37544 Number of extensions: 76781 Number of successful extensions: 132 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 14,793,348 effective HSP length: 50 effective length of database: 12,916,148 effective search space used: 258322960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -