SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0002_B17
         (186 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb...    23   7.0  
SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||...    22   9.3  

>SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1379

 Score = 22.6 bits (46), Expect = 7.0
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 28   PYFKKKKKK 2
            P+FKKKKKK
Sbjct: 1348 PFFKKKKKK 1356


>SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 465

 Score = 22.2 bits (45), Expect = 9.3
 Identities = 7/31 (22%), Positives = 19/31 (61%)
 Frame = +1

Query: 55  VCVLNNNVKHIKYNFCMTVFLMTIQIQVIKI 147
           VC L+ +  H+ ++  + +FL    I+++++
Sbjct: 283 VCCLDPHFLHLSFSGVLFIFLFVEGIRILRL 313


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 481,127
Number of Sequences: 5004
Number of extensions: 4877
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 2,362,478
effective HSP length: 42
effective length of database: 2,152,310
effective search space used: 40893890
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -