BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0002_B17
(186 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 23 7.0
SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||... 22 9.3
>SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr
1|||Manual
Length = 1379
Score = 22.6 bits (46), Expect = 7.0
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -3
Query: 28 PYFKKKKKK 2
P+FKKKKKK
Sbjct: 1348 PFFKKKKKK 1356
>SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr
3|||Manual
Length = 465
Score = 22.2 bits (45), Expect = 9.3
Identities = 7/31 (22%), Positives = 19/31 (61%)
Frame = +1
Query: 55 VCVLNNNVKHIKYNFCMTVFLMTIQIQVIKI 147
VC L+ + H+ ++ + +FL I+++++
Sbjct: 283 VCCLDPHFLHLSFSGVLFIFLFVEGIRILRL 313
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 481,127
Number of Sequences: 5004
Number of extensions: 4877
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 2,362,478
effective HSP length: 42
effective length of database: 2,152,310
effective search space used: 40893890
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -