Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0002_B12
         (488 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory...    22   4.0  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               21   5.3  

>AJ555537-1|CAD88245.1|  210|Apis mellifera putative chemosensory
           receptor 2 protein.
          Length = 210

 Score = 21.8 bits (44), Expect = 4.0
 Identities = 12/41 (29%), Positives = 19/41 (46%)
 Frame = +2

Query: 14  VHVSFAYIVNSHIKQNEIHKCVAVGDPWGVCVRAHCHTAAI 136
           V  +  Y V  H  ++ +    A+GD +GV +  H  T  I
Sbjct: 99  VRSAIKYWVERH--KHIVRLVTAIGDAYGVALLLHMLTTTI 137


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 21.4 bits (43), Expect = 5.3
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +1

Query: 169 RMPEPRLEFIQH 204
           R PEP +E I+H
Sbjct: 490 RQPEPLIELIEH 501


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,019
Number of Sequences: 438
Number of extensions: 3215
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13421061
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)