BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B11 (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 3.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 3.4 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 3.4 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 7.9 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 7.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/25 (28%), Positives = 11/25 (44%) Frame = +2 Query: 233 INKKQNTWKAGRNFPTHTPFAHIKI 307 +N + TW GR PF + + Sbjct: 129 VNSRPETWVLGREMCKAVPFVELTV 153 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 3.4 Identities = 7/25 (28%), Positives = 11/25 (44%) Frame = +2 Query: 233 INKKQNTWKAGRNFPTHTPFAHIKI 307 +N + TW GR PF + + Sbjct: 129 VNSRPETWVLGREMCKAVPFVELTV 153 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 112 LQSRSVNKLTRNSNECSAITEQH 44 L +N N N SA+T QH Sbjct: 367 LSQSGINYKDTNDNNVSAVTTQH 389 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 188 PQQREYTRARRTEHTKEPSFSILFSFTESI 99 P E + + H+ E SFS S+T +I Sbjct: 194 PTCSEASSSPTPSHSSESSFSAASSYTNTI 223 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -2 Query: 482 SESPAAAARSLIPNLVQCRAFGATYPSGRNSLEGLL 375 SE+ ++ S P + CR F A +GL+ Sbjct: 51 SENSEVSSNSYTPKIKSCRPFKAYIKDPLTLAQGLV 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,341 Number of Sequences: 336 Number of extensions: 2873 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -