BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B10 (524 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 31 0.024 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 30 0.055 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 30 0.055 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 30 0.055 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 30 0.055 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 30 0.055 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 30 0.055 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 30 0.055 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 1.6 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 1.6 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 24 2.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 3.6 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 23 4.7 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 8.3 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 31.1 bits (67), Expect = 0.024 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H R+ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMRDAW 63 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 29.9 bits (64), Expect = 0.055 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 279 PFGVALNHPYCARVQNSLP-YFPSEHHKSQIYFLHPRNFW 163 P V NHP C +Q LP YF + S+ Y H ++ W Sbjct: 24 PGEVIPNHPNCPEMQGPLPHYFIHPTNCSRFYECHMKDAW 63 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.0 bits (52), Expect = 1.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 154 SNIPEVPRMKEVNLAFMVLRGEIWEGILNARTI 252 SN+ V +K V++ G +W+GI+N + + Sbjct: 235 SNLYNVDNLKLVSMIGQGKYGTVWKGIVNEKPV 267 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 25.0 bits (52), Expect = 1.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 22 IALCCFFNLFKYYSKAPIWSAY 87 I CC F++ ++ P+W+ Y Sbjct: 147 IYCCCHFSMATFFWFMPVWTTY 168 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 165 WNIGNLLFLGTVQVLPQLKLISQLKAVS 82 WN G L + T+ +P L QLK VS Sbjct: 493 WNYGELKYRATLVNIPANDLKFQLKEVS 520 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/37 (27%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 145 KKISNIPEVPRMKEVNLAFMVLRGEIW-EGILNARTI 252 + ++N ++PR E+ + LR +W EG++ T+ Sbjct: 1620 QSVTNCRQLPRRGEILIFITSLRVSVWLEGVVVQETL 1656 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 161 ILEIFFFSVQFRFCHS*S*YH 99 IL ++ F+FCH+ + YH Sbjct: 218 ILSQYYLQPDFQFCHTFAYYH 238 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 22.6 bits (46), Expect = 8.3 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 219 FPSEHHKSQIYFLHPRNFW 163 F S H +S + + PR+ W Sbjct: 304 FRSSHPQSNFHIIDPRSIW 322 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,427 Number of Sequences: 2352 Number of extensions: 7948 Number of successful extensions: 20 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48205926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -