BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B05 (584 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 27 2.7 SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Sc... 26 4.7 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 63 GTCRPDLNSRINHTCD--CPLGFAGASCQM 146 G C + R+NH+CD C + F GA Q+ Sbjct: 182 GMCLDTILCRLNHSCDPNCQIIFDGAIVQL 211 >SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1958 Score = 25.8 bits (54), Expect = 4.7 Identities = 20/78 (25%), Positives = 29/78 (37%), Gaps = 5/78 (6%) Frame = +2 Query: 119 WICRRFLSNAFAITSKCRLQRQRICRITC-----GIVTLR*FTIRTCSYCARYSYNQRWC 283 W CR +S F Q + R+ G++ L T S +S + WC Sbjct: 1731 WYCRYGVS--FETQPNLNFQNSELSRLQTKMHIPGVIELSNHLCLTAS-STEWSLIKHWC 1787 Query: 284 TFISERGTQSV*PRRLHP 337 F +E G PR +P Sbjct: 1788 NFFTETGPLCDFPRAYYP 1805 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,388,053 Number of Sequences: 5004 Number of extensions: 48052 Number of successful extensions: 124 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -