BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B05 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 29 0.11 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 24 3.2 CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal ... 24 4.2 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.6 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 23 9.6 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 29.1 bits (62), Expect = 0.11 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 36 CSLRPCRNGGTCRPDLNSRINHTCDCPLGFAGASCQM 146 C PC N G C + +CP+G+ G C++ Sbjct: 773 CKRCPCPNNGACMQMAGDTVI-CLECPVGYFGPRCEL 808 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 54 RNGGTCRPDLNSRINHTCDCPLGFA----GASCQ-MPLQL 158 +NGG L + +++C CP+G G +C+ PLQL Sbjct: 7 KNGGCSYICLLNPTSYSCACPIGIQLKDNGKTCKSWPLQL 46 >CR954257-6|CAJ14157.1| 375|Anopheles gambiae RrnaAD, ribosomal RNA adenine dimethylaseprotein. Length = 375 Score = 23.8 bits (49), Expect = 4.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 144 MPLQLLQSVGFSGNGYVE 197 +P QLL+SV S N YV+ Sbjct: 282 LPSQLLKSVPLSSNDYVD 299 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 9.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 140 SNAFAITSKCRLQRQR 187 ++A AI S+C LQRQR Sbjct: 1405 TDAEAIDSECDLQRQR 1420 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 22.6 bits (46), Expect = 9.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 105 CDCPLGFAGASCQMPLQLLQS 167 C C +G+ G +C+ LQ Q+ Sbjct: 492 CQCYVGWIGKTCECNLQNSQN 512 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,756 Number of Sequences: 2352 Number of extensions: 12107 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -