BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B03 (469 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 25 0.35 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 25 0.35 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 1.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 1.1 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 23 1.9 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 3.3 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 21 4.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 4.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 4.3 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 7.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 9.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 9.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 9.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 9.9 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 25.0 bits (52), Expect = 0.35 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Frame = +1 Query: 76 FLKGGLHKLENEFPGLIHSVRGRGTF-LAYNAP---NTETRDKINNKMKQNGVLGGTCGE 243 FL G + + +E +RG T+ LA + E + + MK+N LG CG Sbjct: 131 FLLGFRYLVNDELSAHSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGAACGR 190 Query: 244 V 246 + Sbjct: 191 I 191 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 25.0 bits (52), Expect = 0.35 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 4/61 (6%) Frame = +1 Query: 76 FLKGGLHKLENEFPGLIHSVRGRGTF-LAYNAP---NTETRDKINNKMKQNGVLGGTCGE 243 FL G + + +E +RG T+ LA + E + + MK+N LG CG Sbjct: 445 FLLGFRYLVNDELSAHSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGAACGR 504 Query: 244 V 246 + Sbjct: 505 I 505 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.1 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +1 Query: 76 FLKGGLHKLENEFPGLIHSVRGRGTF-LAYNAP---NTETRDKINNKMKQNGVLGGTCGE 243 FL G + +E +RG T+ LA + E + + MK+N LG CG Sbjct: 678 FLLGFRLQANDELSAHSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGAACGR 737 Query: 244 V 246 + Sbjct: 738 I 738 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.4 bits (48), Expect = 1.1 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +1 Query: 76 FLKGGLHKLENEFPGLIHSVRGRGTF-LAYNAP---NTETRDKINNKMKQNGVLGGTCGE 243 FL G + +E +RG T+ LA + E + + MK+N LG CG Sbjct: 678 FLLGFRLQANDELSAHSKEIRGENTYILALDGDIDFQPEALHLLVDYMKKNKTLGAACGR 737 Query: 244 V 246 + Sbjct: 738 I 738 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 22.6 bits (46), Expect = 1.9 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +3 Query: 249 YSSSTSPYIPKEACRDLFRRIKENFKRVLINKL 347 Y +T+P++ K+ +++ ++EN ++ N L Sbjct: 293 YELATNPHVQKKLQKEIDLTLQENHGKISYNVL 325 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 3.3 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = -1 Query: 163 CTPGTCHGRERC 128 C PG CH C Sbjct: 264 CRPGACHNNGTC 275 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +1 Query: 121 LIHSVRGRGTFLAYNAPNTE-----TRDKINN 201 L+H ++GR T + Y+A + +RD +NN Sbjct: 84 LLHDLKGRTTSVPYDALTGQCIYSISRDYLNN 115 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +1 Query: 121 LIHSVRGRGTFLAYNAPNTE-----TRDKINN 201 L+H ++GR T + Y+A + +RD +NN Sbjct: 84 LLHDLKGRTTSVPYDALTGQCIYSISRDYLNN 115 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 4.3 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +1 Query: 121 LIHSVRGRGTFLAYNAPNTE-----TRDKINN 201 L+H ++GR T + Y+A + +RD +NN Sbjct: 84 LLHDLKGRTTSVPYDALTGQCIYSISRDYLNN 115 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 20.6 bits (41), Expect = 7.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -3 Query: 413 SILNSITTYKLNLI 372 S+LNS+TT+ L +I Sbjct: 233 SVLNSLTTFLLVMI 246 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 205 MKQNGVLGGTCGEV 246 MK+N LG CG + Sbjct: 752 MKKNRNLGAACGRI 765 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 205 MKQNGVLGGTCGEV 246 MK+N LG CG + Sbjct: 752 MKKNRNLGAACGRI 765 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 205 MKQNGVLGGTCGEV 246 MK+N LG CG + Sbjct: 752 MKKNRNLGAACGRI 765 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 9.9 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 205 MKQNGVLGGTCGEV 246 MK+N LG CG + Sbjct: 752 MKKNRNLGAACGRI 765 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,795 Number of Sequences: 336 Number of extensions: 1767 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10826639 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -