BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_B01 (317 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 2.8 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 2.8 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 22 4.8 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 22 4.8 AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long fo... 21 8.4 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 260 TPDVPIFFWAPPYITPNLDTSTFFDIKF 177 TPDV W PP T +D++F Sbjct: 124 TPDVVCITWEPPTREHRNGQITRYDVQF 151 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 206 DTSTFFDIKFDDISATSGTPFVS 138 DT DIK +I+ T+ P+++ Sbjct: 684 DTRVPIDIKMSEIATTTAKPYIA 706 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 147 LCIGYKIKFDTVYGFVCAYM 88 +CI + F V+GF+C Y+ Sbjct: 366 VCIIGGLGFGVVWGFLCKYV 385 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 281 SLTMTSATPDVPIFFWAPPYITPNLDTSTFFDI 183 +LT+ +PIFF+A P + +++ T DI Sbjct: 242 ALTIAGIFISLPIFFFASPQFSASMN-DTICDI 273 >AF457552-1|AAL68782.1| 311|Anopheles gambiae D7 protein long form protein. Length = 311 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 58 WNLDPNASYVHICANETIHGVE 123 W L+PN + H T+ G++ Sbjct: 58 WKLEPNDAVTHCYVKCTLAGLQ 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 356,497 Number of Sequences: 2352 Number of extensions: 7340 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 21181083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -