BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A22 (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 30 1.3 At1g14770.2 68414.m01766 expressed protein 29 1.8 At1g14770.1 68414.m01765 expressed protein 29 1.8 At4g32760.1 68417.m04661 VHS domain-containing protein / GAT dom... 29 3.1 At1g75310.1 68414.m08748 DNAJ heat shock N-terminal domain-conta... 29 3.1 At5g48890.1 68418.m06048 hypothetical protein 28 5.4 At3g45170.1 68416.m04875 zinc finger (GATA type) family protein ... 28 5.4 At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 ... 27 7.1 At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogene... 27 7.1 At3g27785.1 68416.m03466 myb family transcription factor (MYB118... 27 9.4 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 318 LDGFTSERTRSVTTGNLSGSASSVTTTIKRQRTSNWKL 431 +D TS+R+R GNL+ S TTT+ + + W+L Sbjct: 950 VDRRTSKRSRRTNYGNLTSLKVSATTTVYQLKMMIWEL 987 >At1g14770.2 68414.m01766 expressed protein Length = 429 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/87 (26%), Positives = 37/87 (42%) Frame = +2 Query: 146 RPISLVIIQHTVTPTCETNEACMVTMRSLQDNHMDNLKYWDIGMNFVVGGNGKVYEGSGW 325 R +SL+ Q + TP ETN+ RS+ HMD + + + GN K Sbjct: 152 RDVSLMENQTSATPFMETNDPVFRDDRSV---HMDLCEEEPVDEQQLHIGNAKEPTDEQH 208 Query: 326 LHVGAHTIGYNRKSIGISFVGNYNNKE 406 +H+G + + + I N N K+ Sbjct: 209 VHIGNEKESIDEQQVHIGLELNRNEKD 235 >At1g14770.1 68414.m01765 expressed protein Length = 429 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/87 (26%), Positives = 37/87 (42%) Frame = +2 Query: 146 RPISLVIIQHTVTPTCETNEACMVTMRSLQDNHMDNLKYWDIGMNFVVGGNGKVYEGSGW 325 R +SL+ Q + TP ETN+ RS+ HMD + + + GN K Sbjct: 152 RDVSLMENQTSATPFMETNDPVFRDDRSV---HMDLCEEEPVDEQQLHIGNAKEPTDEQH 208 Query: 326 LHVGAHTIGYNRKSIGISFVGNYNNKE 406 +H+G + + + I N N K+ Sbjct: 209 VHIGNEKESIDEQQVHIGLELNRNEKD 235 >At4g32760.1 68417.m04661 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 838 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 323 WLHVGAHTIGYNRKSIGISFVGNYNNKEATNQQLEAVRSL 442 W++ G+ T GY R +S++ K +QL+ VR+L Sbjct: 261 WIYSGSQTRGYGRSGGAVSYI---QTKSGAPRQLDFVRAL 297 >At1g75310.1 68414.m08748 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q27974 Auxilin {Bos taurus}; contains Pfam profile PF00226: DnaJ domain Length = 1448 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 284 RNSSRCPNISNYPYDCLVNFASSPCMLRSSHRSE*RCAGLSPG*SAEANT 135 R+ S C +SN Y + +S C L H + R +GL+ G S T Sbjct: 243 RDDSTCKTVSNGEYRDVKPPSSFQCTLNGEHGASERLSGLNSGPSERYET 292 >At5g48890.1 68418.m06048 hypothetical protein Length = 173 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -1 Query: 298 VATYDEIHPDVPIFQII-HMIVL*TSHRHHAC 206 VA + +HPD PIF+ +VL TSH+ C Sbjct: 106 VACFPTVHPDHPIFKSSGSHVVLATSHQGRDC 137 >At3g45170.1 68416.m04875 zinc finger (GATA type) family protein contains GATA-type zinc finger domain, INTERPRO:IPR000679 Length = 204 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 337 SDVKPSRTFVNFPVATYDEIH 275 +D KPSR F N P AT +H Sbjct: 62 NDSKPSRNFSNLPTATRGRLH 82 >At3g01510.1 68416.m00077 5'-AMP-activated protein kinase beta-1 subunit-related contains similarity to Swiss-Prot:P80387 5'-AMP-activated protein kinase, beta-1 subunit (AMPK beta-1 chain) (AMPKb) (40 kDa subunit) [Sus scrofa] Length = 591 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 269 IGMNFVVGGNGKVYEGSGWLHVGA-HTIGYNRK 364 IG +F GNG+V++G G ++G+ G+NR+ Sbjct: 22 IGSSFR-SGNGRVFDGRGIAYLGSREKFGFNRR 53 >At2g32950.1 68415.m04039 COP1 regulatory protein photomorphogenesis repressor; identical to COP1 regulatory protein/FUSCA protein FUS1 GI:402685 SP:P43254 Length = 675 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +2 Query: 317 SGWLHVGAHTIGYNRKSIGI---SFVGNYNNKE 406 + W H + IG+N S+ I +FVGNY NK+ Sbjct: 228 NAWPHE-KNQIGFNSNSLSIRGGNFVGNYQNKK 259 >At3g27785.1 68416.m03466 myb family transcription factor (MYB118) contains PFAM profile: PF00249 myb-like DNA binding domain Length = 437 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 354 TTGNLSGSASSVTTTIKRQRTSNWKL*DHC 443 T+G+ SGS S VT I T +W + C Sbjct: 389 TSGSASGSGSGVTMEIDEPMTDSWMVMHGC 418 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,852,906 Number of Sequences: 28952 Number of extensions: 302365 Number of successful extensions: 902 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 902 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -