BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A20 (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0880 + 29046842-29046990,29047467-29047701,29048132-290482... 29 2.3 07_03_0455 + 18374327-18374533,18375136-18375482,18375959-183761... 29 3.0 >04_04_0880 + 29046842-29046990,29047467-29047701,29048132-29048227, 29048887-29048958,29049091-29049195 Length = 218 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 98 EYNFYQILRFVIKGRSRIT*ATF--VYLIKPILMLQWKGW 211 EY Q+ F++KGR+R+ L++P+L L W W Sbjct: 69 EYLQGQVAEFIVKGRARMPDLVIDSSSLLQPLLKLGWTQW 108 >07_03_0455 + 18374327-18374533,18375136-18375482,18375959-18376193, 18376629-18376724,18377392-18377463,18377596-18377700 Length = 353 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +2 Query: 98 EYNFYQILRFVIKGRSRIT*ATF--VYLIKPILMLQWKGW 211 EY Q+ FV+KGR+R+ L++P+L L W W Sbjct: 204 EYFQGQVPEFVVKGRARMPDLVIDSSSLLQPLLKLGWTQW 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,498,580 Number of Sequences: 37544 Number of extensions: 224786 Number of successful extensions: 402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 402 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -