BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A20 (525 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) 27 9.5 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 187 SYVTMEGVGSVRVLLSIANNVVGRVTNILNPFYVILEWSFISPLV 321 SY E +G + L +N + +VT + +VIL W F P + Sbjct: 291 SYYRQESLGMIS--LDALDNSLSKVTKLAGNRHVILTWDFNLPSI 333 >SB_23438| Best HMM Match : zf-CCHC (HMM E-Value=0.00065) Length = 1275 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 210 GKCKSFAFYC*QCGGESH 263 GKCK+F C +CG ++H Sbjct: 1007 GKCKAFGQVCSKCGKKNH 1024 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,992,307 Number of Sequences: 59808 Number of extensions: 282129 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -