BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A20 (525 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.9 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 22 4.4 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 21 5.8 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 21 5.8 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 5.8 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 7.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 7.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.7 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 166 CLFN*ANSYVTMEGVGSVRVLLSIANNVVGRVTNIL 273 C +N +SYV +GS + + + V GR++ ++ Sbjct: 190 CSYNMDSSYVIFSAMGSFFLPMLVMLYVYGRISCVI 225 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 73 LLKISERLFCYFPLKIV*QL 14 L+KIS+ L C+F K + Q+ Sbjct: 113 LIKISKILECFFKYKTINQI 132 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 280 KDLKYL*LSPPHC 242 KDL YL SPP C Sbjct: 75 KDLVYLEPSPPFC 87 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 280 KDLKYL*LSPPHC 242 KDL YL SPP C Sbjct: 76 KDLVYLEPSPPFC 88 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -1 Query: 507 SASAFHFTPTPRPAVTRHAIE*RKNLRQWKKVSL 406 SA F + T P + + N+R+W +++ Sbjct: 94 SAEKFECSKTSNPCLPHRNSDRDLNIRKWSSIAI 127 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 148 NYVSNVCLFN*ANSY 192 NY+SN+ +N N+Y Sbjct: 88 NYISNISNYNNNNNY 102 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 148 NYVSNVCLFN*ANSY 192 NY+SN+ +N N+Y Sbjct: 88 NYISNISNYNNDNNY 102 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 148 NYVSNVCLFN*ANSY 192 NY+SN+ +N N+Y Sbjct: 326 NYISNISNYNNNNNY 340 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,289 Number of Sequences: 438 Number of extensions: 3097 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -