BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A18 (474 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 21 5.8 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 5.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.7 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 21.0 bits (42), Expect = 5.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 457 ELDEAIKDPSTNPNYLPAITE 395 ++DE +K+ NYL I E Sbjct: 28 DIDEILKNDRLTKNYLDCILE 48 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 5.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 436 DPSTNPNYLPAITESYRYL 380 D ST PNYL ++ YL Sbjct: 12 DSSTQPNYLILSNKNNTYL 30 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 7.7 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = -3 Query: 427 TNPNYLPAITESYRYLKSTHEHGNKPENSI 338 T P+Y P T ++ K+T +P ++ Sbjct: 1170 TKPSYRPPSTTNHWQTKTTTSTTTRPTTTV 1199 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,248 Number of Sequences: 336 Number of extensions: 1861 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -