BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A16 (450 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF078787-7|AAC26954.2| 518|Caenorhabditis elegans Vegf (vascula... 28 2.7 AC025722-7|AAK68510.1| 540|Caenorhabditis elegans Hypothetical ... 27 8.3 >AF078787-7|AAC26954.2| 518|Caenorhabditis elegans Vegf (vascular endothelial growthfactor) receptor family protein 2 protein. Length = 518 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -1 Query: 213 HRNLSFKIRRQSALLQKWVLYTRCQTCNQSILMKYLKKV 97 H + +KIR Q A+ + LY + N L+KYL+K+ Sbjct: 59 HSLIEYKIRLQVAVKRYGFLYVITEYINGGDLLKYLRKL 97 >AC025722-7|AAK68510.1| 540|Caenorhabditis elegans Hypothetical protein Y50D4C.5 protein. Length = 540 Score = 26.6 bits (56), Expect = 8.3 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -3 Query: 337 KVYVRAMDISTWTLAELNEAIANPATNP--ELIHYLETARTKLTSESEFQN 191 K+ RAMDI +A L+E + NP+ + E+I E R + E Q+ Sbjct: 439 KLRTRAMDIDQQRIALLDEKLDNPSVDDVREIIFLREIMRRVWSINRELQD 489 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,411,523 Number of Sequences: 27780 Number of extensions: 157310 Number of successful extensions: 413 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 413 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -