BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A14 (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001612-1|AAN71367.1| 460|Drosophila melanogaster RE32823p pro... 154 8e-38 AF148814-1|AAF26671.1| 431|Drosophila melanogaster translation ... 154 8e-38 AF148813-1|AAF26670.1| 360|Drosophila melanogaster translation ... 154 8e-38 AE014297-4355|AAN14165.1| 431|Drosophila melanogaster CG11901-P... 154 8e-38 AE014297-4354|AAF56877.2| 431|Drosophila melanogaster CG11901-P... 154 8e-38 BT012478-1|AAS93749.1| 341|Drosophila melanogaster RE15368p pro... 40 0.003 >BT001612-1|AAN71367.1| 460|Drosophila melanogaster RE32823p protein. Length = 460 Score = 154 bits (373), Expect = 8e-38 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQYKYPEELAKVS*AVT*SPAV-QRLDRCXXXXXXXXXXXXX 177 SIPYF++KFD E+YSIW+ +YKY EEL+KV + + QRLD+ Sbjct: 330 SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE 389 Query: 178 XXXXXXXXVWVWRGHELAFPLSPDWQIDYESYEWTKLDPHSPDTKALLRDYFSWTGTDQD 357 +WVWRG +LAF LSPDWQIDYE Y+W KLD S +TK L+ YFSW+GTD+D Sbjct: 390 DGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKD 449 Query: 358 GRKFNQGKIFK 390 GRKFNQGKIFK Sbjct: 450 GRKFNQGKIFK 460 >AF148814-1|AAF26671.1| 431|Drosophila melanogaster translation elongation factor1 gamma protein. Length = 431 Score = 154 bits (373), Expect = 8e-38 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQYKYPEELAKVS*AVT*SPAV-QRLDRCXXXXXXXXXXXXX 177 SIPYF++KFD E+YSIW+ +YKY EEL+KV + + QRLD+ Sbjct: 301 SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE 360 Query: 178 XXXXXXXXVWVWRGHELAFPLSPDWQIDYESYEWTKLDPHSPDTKALLRDYFSWTGTDQD 357 +WVWRG +LAF LSPDWQIDYE Y+W KLD S +TK L+ YFSW+GTD+D Sbjct: 361 DGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKD 420 Query: 358 GRKFNQGKIFK 390 GRKFNQGKIFK Sbjct: 421 GRKFNQGKIFK 431 >AF148813-1|AAF26670.1| 360|Drosophila melanogaster translation elongation factor1 gamma protein. Length = 360 Score = 154 bits (373), Expect = 8e-38 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQYKYPEELAKVS*AVT*SPAV-QRLDRCXXXXXXXXXXXXX 177 SIPYF++KFD E+YSIW+ +YKY EEL+KV + + QRLD+ Sbjct: 230 SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE 289 Query: 178 XXXXXXXXVWVWRGHELAFPLSPDWQIDYESYEWTKLDPHSPDTKALLRDYFSWTGTDQD 357 +WVWRG +LAF LSPDWQIDYE Y+W KLD S +TK L+ YFSW+GTD+D Sbjct: 290 DGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKD 349 Query: 358 GRKFNQGKIFK 390 GRKFNQGKIFK Sbjct: 350 GRKFNQGKIFK 360 >AE014297-4355|AAN14165.1| 431|Drosophila melanogaster CG11901-PB, isoform B protein. Length = 431 Score = 154 bits (373), Expect = 8e-38 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQYKYPEELAKVS*AVT*SPAV-QRLDRCXXXXXXXXXXXXX 177 SIPYF++KFD E+YSIW+ +YKY EEL+KV + + QRLD+ Sbjct: 301 SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE 360 Query: 178 XXXXXXXXVWVWRGHELAFPLSPDWQIDYESYEWTKLDPHSPDTKALLRDYFSWTGTDQD 357 +WVWRG +LAF LSPDWQIDYE Y+W KLD S +TK L+ YFSW+GTD+D Sbjct: 361 DGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKD 420 Query: 358 GRKFNQGKIFK 390 GRKFNQGKIFK Sbjct: 421 GRKFNQGKIFK 431 >AE014297-4354|AAF56877.2| 431|Drosophila melanogaster CG11901-PA, isoform A protein. Length = 431 Score = 154 bits (373), Expect = 8e-38 Identities = 71/131 (54%), Positives = 87/131 (66%), Gaps = 1/131 (0%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQYKYPEELAKVS*AVT*SPAV-QRLDRCXXXXXXXXXXXXX 177 SIPYF++KFD E+YSIW+ +YKY EEL+KV + + QRLD+ Sbjct: 301 SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE 360 Query: 178 XXXXXXXXVWVWRGHELAFPLSPDWQIDYESYEWTKLDPHSPDTKALLRDYFSWTGTDQD 357 +WVWRG +LAF LSPDWQIDYE Y+W KLD S +TK L+ YFSW+GTD+D Sbjct: 361 DGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKD 420 Query: 358 GRKFNQGKIFK 390 GRKFNQGKIFK Sbjct: 421 GRKFNQGKIFK 431 >BT012478-1|AAS93749.1| 341|Drosophila melanogaster RE15368p protein. Length = 341 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/21 (66%), Positives = 19/21 (90%) Frame = +1 Query: 1 SIPYFWEKFDPEHYSIWYCQY 63 SIPYF++KFD E+YSIW+ +Y Sbjct: 321 SIPYFFDKFDTENYSIWFGEY 341 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,926,782 Number of Sequences: 53049 Number of extensions: 392162 Number of successful extensions: 1321 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1306 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -