BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A13 (612 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_08_0033 + 27820563-27823482,27823593-27823996 30 1.7 11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 28 5.1 06_03_0499 + 21461608-21463427,21463517-21463627,21463867-214641... 28 6.7 12_02_1069 + 25801309-25801433,25802429-25802620,25803130-258031... 27 8.9 >11_08_0033 + 27820563-27823482,27823593-27823996 Length = 1107 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 65 GVTENVSLQDKRCRRSVCGAPEKGFIPFP 151 GV N++L+ R +CG+P G +P P Sbjct: 709 GVFSNITLKSLRGNAGLCGSPRLGLLPCP 737 >11_04_0315 + 16306053-16306753,16306779-16308479,16308894-16309257 Length = 921 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 363 YAKDFETFYKSAAFARVHLNEGQFLYAYYIAV 458 Y KD FY + + + EG+FL ++Y+ + Sbjct: 697 YVKDSRLFYSFSESTKELVQEGEFLQSFYVQI 728 >06_03_0499 + 21461608-21463427,21463517-21463627,21463867-21464143, 21464265-21464353,21464508-21464595,21464698-21464907, 21464985-21465110,21465429-21465620,21466532-21467188 Length = 1189 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 410 TSESGTLVEGFKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQF 264 +S +G + FK+ +++E K + L EDG++++ K DS+ F Sbjct: 599 SSSNGPVEREFKILNLLEFNSKRKRMSVILKDEDGQILLFCKGADSIIF 647 >12_02_1069 + 25801309-25801433,25802429-25802620,25803130-25803159, 25803426-25803500,25803599-25804373,25804549-25804614, 25804746-25804811,25804898-25805140,25805407-25805502 Length = 555 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 388 TRVPLSL-VCT*MRDSSCTHIILQLSSAMILMDSFYQLLMK 507 T+ P S V T + S+CTH QLSSA +L + +K Sbjct: 65 TQCPCSFAVATSISSSTCTHFTPQLSSAHLLSSQLKEKELK 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,256,642 Number of Sequences: 37544 Number of extensions: 301502 Number of successful extensions: 673 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -