BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A12 (480 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) 27 8.0 >SB_56705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.5 bits (58), Expect = 6.1 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +2 Query: 275 HQFEAVIMFNVLYSAKDYDTFYKTTVY--MKDRVNQDLYIYVLSTLHIHR 418 HQF I+F+ ++ Y TF + DR+ DL +Y +S I R Sbjct: 9 HQFPFNILFHKMFITHFYSTFIELAQLHDQHDRLELDLILYAISDALIIR 58 >SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 334 CVVVFSGIQDIEHYDSFKL 278 C VVFSGIQ + YD +K+ Sbjct: 409 CGVVFSGIQIAKEYDFYKM 427 >SB_54333| Best HMM Match : Glyco_hydro_39 (HMM E-Value=0) Length = 1325 Score = 27.1 bits (57), Expect = 8.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 269 PTHQFEAVIMFNVLYSAKDYDTFYKTTVYMKDRVNQDLYIYV 394 P H F A + + + K YD+ Y T +Y RV Q Y Y+ Sbjct: 899 PRHLFHAYLHHDTRTTGK-YDS-YSTRIYTTTRVRQLFYAYL 938 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,202,737 Number of Sequences: 59808 Number of extensions: 268937 Number of successful extensions: 657 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -