BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A10 (682 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 28 0.081 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 23 1.8 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 5.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 7.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.3 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 27.9 bits (59), Expect = 0.081 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +1 Query: 535 CVKDYFCNNNEMTNKDDPDNV---DXSGPYGGCSSFLDICCS 651 C K Y CN+ ++T K PD + D S Y C +I C+ Sbjct: 52 CDKYYECNDGQITEKLCPDGMVFNDYSSEYEKCDLPFNIDCT 93 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 120 YEIYFKTKTLNSNITDNTFLAVVSLCFLIIFI 25 +EI K ++ + + T F+ V L FL+IF+ Sbjct: 99 FEILLKLESKDLSRTFYGFVIVAHLLFLVIFV 130 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 615 IRATXIDIIRVIFIGHFVVVAKVVFY 538 + AT I+ ++F HF+ + +FY Sbjct: 229 LNATYGLILLLMFTSHFIFIVVSIFY 254 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 457 SAPSAIVPTVNTNDTPCITKTGQEGVCVKDYFCNNNEMTN 576 SA S NTN+ P T + + CN+ MT+ Sbjct: 1011 SATSNSSVNANTNNIPTNAGTTPGAILAFSWACNDAVMTS 1050 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 453 NGGWFLSSSGDGYRIDC 403 NGG S G GY DC Sbjct: 387 NGGVCRISDGGGYICDC 403 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,891 Number of Sequences: 336 Number of extensions: 3965 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -