BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A08 (481 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 2.6 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 3.4 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 2.6 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = -2 Query: 165 LLIGVSNLVLKLLIFHGGLHVEAVRLESILRLNSVL-----LFFIFSPVLLGLIDHT 10 L I S ++L I+H +H+ +L S + ++L + FI + + G + H+ Sbjct: 45 LNITASAVLLPFAIYHIFMHIVPTKLISFYKSTAILEIAFEVIFIVTVWMTGAVKHS 101 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 90 LESILRLNSVLLFFIFSPVLLGLI 19 L + L S+L+FFIF +L ++ Sbjct: 233 LPCVFFLGSILIFFIFPLAILIIV 256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,158 Number of Sequences: 336 Number of extensions: 1546 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11247091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -