BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A07 (628 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC039102-1|AAH39102.1| 268|Homo sapiens Unknown (protein for IM... 36 0.16 >BC039102-1|AAH39102.1| 268|Homo sapiens Unknown (protein for IMAGE:4829003) protein. Length = 268 Score = 35.5 bits (78), Expect = 0.16 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = -1 Query: 232 LTKLYKHRKLVLPLLKKKHSDLFSKKQVSISILNTKLTT*PKRK 101 ++KLY+ + + L ++KH +L KK++ IS LN KL + K K Sbjct: 147 ISKLYQDMQRKVELNEEKHKELIEKKEMEISELNAKLRSQVKEK 190 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,157,789 Number of Sequences: 237096 Number of extensions: 1192877 Number of successful extensions: 1887 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1887 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6804036910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -