BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0002_A06 (319 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 20 5.5 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 20 5.5 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 20 5.5 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 20 5.5 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 20 5.5 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 19 9.5 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 20.2 bits (40), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 92 RELCKLGLRPRDLRRERVDNAATGRG 15 + L +LGLR D + D+ G+G Sbjct: 166 QHLQELGLRLEDANSDEQDDGDDGQG 191 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 20.2 bits (40), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 92 RELCKLGLRPRDLRRERVDNAATGRG 15 + L +LGLR D + D+ G+G Sbjct: 166 QHLQELGLRLEDANSDEQDDGDDGQG 191 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 20.2 bits (40), Expect = 5.5 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 301 PNQCLVKDRIVGLK 260 PNQC++ R++ K Sbjct: 134 PNQCVICHRVLSCK 147 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 20.2 bits (40), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 92 RELCKLGLRPRDLRRERVDNAATGRG 15 + L +LGLR D + D+ G+G Sbjct: 166 QHLQELGLRLEDANSDEQDDGDDGQG 191 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 20.2 bits (40), Expect = 5.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 293 VSSKRSNCRFKSL**TRRPIEEPVVFGRHYRL 198 VSS+ S +FK L RR +E + G + RL Sbjct: 208 VSSEVSLPQFKVLGHRRRAVEISLTTGNYSRL 239 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 19.4 bits (38), Expect = 9.5 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 232 KSQSFLADITDCPARFPGSYKVN 164 + +S L D+T+ + GSY N Sbjct: 39 EEKSSLIDLTESEEKSGGSYSSN 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,451 Number of Sequences: 336 Number of extensions: 1494 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5942776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -