BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P24 (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 24 2.6 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 4.5 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 23 6.0 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.0 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 6.0 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.9 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 24.2 bits (50), Expect = 2.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 247 NCSSAFRFPLRSPSFSKVFNC 185 +CS + L SPSFS ++ C Sbjct: 42 HCSLSLSLSLLSPSFSPIWQC 62 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -1 Query: 276 LNHRYLSHIGTVHPHLDFPLGVHLSL 199 L+H + H +H HL P H L Sbjct: 348 LHHHHPGHHAALHAHLGVPTSQHHQL 373 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.0 bits (47), Expect = 6.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -3 Query: 121 YPTEANNIAHDLPISPLPTIPTFSD 47 Y +E++N HD+ + + P F+D Sbjct: 239 YDSESSNQQHDIALIRIEQTPPFTD 263 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 6.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 184 TLISAIASVICFSTTSNKVTWYPTEANNIAHDLPISPLPTIPTFSDLNLEAMTT 23 T I+ A + S+T+N V Y TE+ D P + + + +L+A+TT Sbjct: 153 TGIACSAKIASHSSTNNSVLPYITESPTDLTDAPTTS-NMAASGDETDLDAITT 205 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 6.0 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 184 TLISAIASVICFSTTSNKVTWYPTEANNIAHDLPISPLPTIPTFSDLNLEAMTT 23 T I+ A + S+T+N V Y TE+ D P + + + +L+A+TT Sbjct: 154 TGIACSAKIASHSSTNNSVLPYITESPTDLTDAPTTS-NMAASGDETDLDAITT 206 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 300 FVQECVPENLELKKKVFQNLDNVVDDN 380 F+ + +N +++KVF + NVV D+ Sbjct: 19 FLLHSLAQNPTIQEKVFDEVRNVVGDD 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,457 Number of Sequences: 2352 Number of extensions: 11041 Number of successful extensions: 33 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -