BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P22 (393 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.27 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 0.47 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 2.5 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 7.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 7.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 7.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 7.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.0 bits (52), Expect = 0.27 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = +1 Query: 4 ETALHPSVFKGTNSQRILQRYTNAGLSNDAFPVNTHRSIRVSKAPYSSENKVYTCRALRV 183 ET LH + K TN + YT+ G P++ V +AP + + V + ++ Sbjct: 1161 ETILH-GLKKYTNYSMEVLAYTSGGDGVRTTPIHCQTEQDVPEAPIAVKALVMSTDSILA 1219 Query: 184 SW 189 SW Sbjct: 1220 SW 1221 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 0.47 Identities = 11/48 (22%), Positives = 19/48 (39%) Frame = +1 Query: 220 PSSQAVPIYRTLIKAKELKNAGWRALTSLSAEKGYHLWNADVRTDDNP 363 PS + P+ + +L N L + KG+H W + +P Sbjct: 30 PSLRGTPLAMLAAQCNKLSNKSPPPLADAAVGKGFHPWKKSPQGAPSP 77 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 2.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 309 CRKRLSFMECRCKN 350 C R++ EC CKN Sbjct: 121 CVDRIADFECNCKN 134 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 245 TGHLSKRRNLRTPDGGR*H 301 +GH+S+RR++ G H Sbjct: 1158 SGHISRRRSMSASSRGDHH 1176 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 245 TGHLSKRRNLRTPDGGR*H 301 +GH+S+RR++ G H Sbjct: 1158 SGHISRRRSMSASSRGDHH 1176 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 245 TGHLSKRRNLRTPDGGR*H 301 +GH+S+RR++ G H Sbjct: 1158 SGHISRRRSMSASSRGDHH 1176 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 245 TGHLSKRRNLRTPDGGR*H 301 +GH+S+RR++ G H Sbjct: 1158 SGHISRRRSMSASSRGDHH 1176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.316 0.129 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,668 Number of Sequences: 336 Number of extensions: 2002 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8330471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.7 bits)
- SilkBase 1999-2023 -