BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P19 (574 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 29 0.037 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 27 0.11 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 27 0.11 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 4.3 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 5.6 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 21 7.5 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 21 7.5 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 28.7 bits (61), Expect = 0.037 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 2/74 (2%) Frame = +1 Query: 343 LIDVEVHYNKVGKNKSRIFTTI--PRFSEGRPVTLGTIDNQGRIVGYPDYSWHDNQGNNC 516 LID + N+ R + + P+ +E P T+ + D RI WH+ Sbjct: 259 LIDQSLALNRGRDENPRTYRSDEGPQITELEPETIESQDAITRIYAIATM-WHETPEEMM 317 Query: 517 DGLTSVFRVAIDEC 558 + L SVFR+ D+C Sbjct: 318 EFLKSVFRLDQDQC 331 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.11 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 409 PRFSEGRPVTLGTIDNQGRIVGYPDYSWHDNQGNNCDGLTSVFRVAIDEC 558 P+ +E P T+ + D RI WH+ + L SVFR+ D+C Sbjct: 516 PQITELEPETIESQDAITRIYACGTM-WHETPEEMMEFLKSVFRLDQDQC 564 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.11 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 409 PRFSEGRPVTLGTIDNQGRIVGYPDYSWHDNQGNNCDGLTSVFRVAIDEC 558 P+ +E P T+ + D RI WH+ + L SVFR+ D+C Sbjct: 516 PQITELEPETIESQDAITRIYACGTM-WHETPEEMMEFLKSVFRLDQDQC 564 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 4.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 490 WHDNQGNN 513 WH+N GNN Sbjct: 376 WHNNNGNN 383 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 282 GKNVFNICPPSDNTKITFSCQT 217 G+++FNI P D+ ++ T Sbjct: 145 GQSIFNITSPDDHDRLRMYINT 166 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.0 bits (42), Expect = 7.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 330 RNIVMLI*SGLLRLFTGKNVFNICPPSDNTKITFS 226 RN + SGL L TG +F PSD + FS Sbjct: 155 RNSNHWVRSGLFALITGNVLFYPFLPSDVSYNLFS 189 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.0 bits (42), Expect = 7.5 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 330 RNIVMLI*SGLLRLFTGKNVFNICPPSDNTKITFS 226 RN + SGL L TG +F PSD + FS Sbjct: 111 RNSNHWVRSGLFALITGNVLFYPFLPSDVSYNLFS 145 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,760 Number of Sequences: 336 Number of extensions: 2966 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -