BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P19 (574 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1711.14 |rec15||meiotic recombination protein Rec15|Schizosa... 27 2.6 SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 27 2.6 SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||... 27 2.6 SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyce... 26 3.4 SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces po... 26 3.4 SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 6.0 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 25 7.9 >SPBC1711.14 |rec15||meiotic recombination protein Rec15|Schizosaccharomyces pombe|chr 2|||Manual Length = 180 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 275 TYSISAHPLITRRLLLAAKPGQQHAK 198 +YS+SA L +R+L + A+ QQH K Sbjct: 2 SYSVSAAQLWSRKLAMQAEDMQQHQK 27 >SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1060 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 215 GQQHAKQYNIHTLWKPYHISNLRSPSLYESQ 123 G+QH ++HT + P S + S SL SQ Sbjct: 169 GKQHLSSLSLHTHFNPSSSSTVSSDSLESSQ 199 >SPAC17A5.01 |pex6||peroxin-6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 948 Score = 26.6 bits (56), Expect = 2.6 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +1 Query: 286 EQAKQTALDKHYYIPGSSVLI--DVEVHYNKVGKNKSRIFTTIPR 414 ++ K+T D I ++ DV+V N++ K KS T+P+ Sbjct: 607 DRIKRTGYDNDSIILSGPIITEQDVDVSINRIRKEKSNTIFTVPK 651 >SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyces pombe|chr 2|||Manual Length = 579 Score = 26.2 bits (55), Expect = 3.4 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 262 DIEYVFPSEQAKQTALDKHYYIPGSSVLIDVEVHY 366 DIE V P E+A Q + K YI S ++ +V + Sbjct: 9 DIESVLPEEKAPQVSEAKKDYISQESTVLSGQVDF 43 >SPAC1F5.02 |||protein disulfide isomerase|Schizosaccharomyces pombe|chr 1|||Manual Length = 492 Score = 26.2 bits (55), Expect = 3.4 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 203 AKQYNIHTLWKPYHISNLRSPSLYESQTNKRT 108 AKQ N+ + W + I+NL+S Y T + T Sbjct: 294 AKQMNVESDWPAFVIANLKSMLKYPFPTTELT 325 >SPAC1F3.08c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 108 Score = 25.4 bits (53), Expect = 6.0 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -2 Query: 471 DYSSLVIYSPQRHRPSFTKSRYCREYSRFILAY--FIIMY 358 D SLV +P + F R C +Y +L Y FII Y Sbjct: 30 DTVSLVSNAPNIYSIPFFYDRICYDYKNILLKYELFIIYY 69 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 25.0 bits (52), Expect = 7.9 Identities = 12/57 (21%), Positives = 27/57 (47%) Frame = +3 Query: 45 ILNNHKHDKLYGFEVITILEVSPFVRLRLV*AWRS*VRNVVRFPESMYVVLFSVLLA 215 I+ +HD++ I +++ VR + W++ V N R + L S++++ Sbjct: 1857 IIGQERHDRILSTLYIVRQDIAAVVRTPAIQIWKAIVVNTPRTVREILPTLTSIIVS 1913 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,495,429 Number of Sequences: 5004 Number of extensions: 53573 Number of successful extensions: 166 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -