BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P17 (576 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38707| Best HMM Match : p450 (HMM E-Value=9.3e-13) 30 1.6 SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_38707| Best HMM Match : p450 (HMM E-Value=9.3e-13) Length = 435 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 325 SKRNVVDYAYKLVRKGEIGIVRDYFPIHFRWILLGEQVKFIN 450 S R+ + A K + G+ G+V+DY + F +LGE + FIN Sbjct: 64 SPRSRISRAGKQPQTGKAGLVKDYGDV-FTLRILGESIVFIN 104 >SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 27.5 bits (58), Expect = 8.3 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 376 IGIVRDYFPIHFRWILLGEQVKFINLRDANALKLEWGTDRDGDRGAYGDKNEWESDRM 549 +G V +YF I F + + EQV F N+ DA + TD+ G + + E D++ Sbjct: 120 VGQVLEYFSIDFEYSVRLEQVSFNNM-DARETDF-YSTDQRGFYNIFNETVETFKDKI 175 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,453,516 Number of Sequences: 59808 Number of extensions: 311924 Number of successful extensions: 750 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -