BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P16 (649 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 38 3e-04 AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 25 2.1 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 25 2.7 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 3.6 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 24 4.8 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 24 4.8 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 24 4.8 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 24 4.8 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 24 4.8 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 24 4.8 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 24 4.8 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 24 4.8 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 24 4.8 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 24 4.8 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 24 4.8 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 24 4.8 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 24 4.8 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 24 4.8 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 24 4.8 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 24 4.8 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 24 4.8 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 24 4.8 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.3 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 37.9 bits (84), Expect = 3e-04 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = +2 Query: 548 SMLVLSRXQMRSSVT-ASGGPAACDTLLILDSVLL 649 SM++LSR QMRSS+ G A CDT+LIL SVL+ Sbjct: 104 SMVILSRPQMRSSINYLLIGLARCDTVLILTSVLI 138 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 25.0 bits (52), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 287 PVEQSDTVRHATSRHVAVEL-RR*HTKEYLKR 379 P E S R + SRH +EL + H YL R Sbjct: 2 PKESSKRTRQSYSRHQTIELEKEFHFNRYLNR 33 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 559 HEHGERVAEQTSRADRIQQHAMHHEPE 479 H G + + A I HA+HH+PE Sbjct: 382 HVPGTKSVLEAGTAVMIPVHAIHHDPE 408 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 607 RPTRSSDGRAHLRAR*HEHGERVAEQTSRADRIQQHAMHHEPE 479 R +R SD R + R ++ Q ++ R QQH H P+ Sbjct: 197 RKSRRSDNRRNERES--TQYQQSVHQPQQSSRDQQHGAQHRPQ 237 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 32 RFKDTFEHFYGAHNFNYHDQ 51 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 32 RFKDTFEHFYGAHNFNYHDQ 51 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 34 RFKDTFEHFYGAHNFNYHDQ 53 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 34 RFKDTFEHFYGAHNFNYHDQ 53 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 37 RFKDTFEHFYGAHNFNYHDQ 56 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 37 RFKDTFEHFYGAHNFNYHDQ 56 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 47 RFKDTFEHFYGAHNFNYHDQ 66 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 49 RFKDTFEHFYGAHNFNYHDQ 68 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 49 RFKDTFEHFYGAHNFNYHDQ 68 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 31 RFKDTFEHFYGAHNFNYHDQ 50 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 31 RFKDTFEHFYGAHNFNYHDQ 50 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 34 RADKTFTHHYKMYLFNYHLQ 93 R TF H Y + FNYH Q Sbjct: 46 RFKDTFEHFYGAHNFNYHDQ 65 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 462 CTPTSDSQPSSSCDAFISWSCRSGSCAPLFKY 367 CTP Q ++ +W+ +S C LF + Sbjct: 85 CTPVLSRQRATRAPTTSTWTSKSVLCEELFLF 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,051 Number of Sequences: 2352 Number of extensions: 11997 Number of successful extensions: 69 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -