BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P16 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 29 0.051 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 29 0.051 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 29 0.051 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 26 0.36 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 21 7.8 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 28.7 bits (61), Expect = 0.051 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 117 NNCRIVECQCSCECPRLFSGYTGVLDCV 200 N C + E C+ P ++SGY G L C+ Sbjct: 217 NMCALCEKPEVCDYPDIYSGYEGALRCL 244 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 28.7 bits (61), Expect = 0.051 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 117 NNCRIVECQCSCECPRLFSGYTGVLDCV 200 N C + E C+ P ++SGY G L C+ Sbjct: 217 NMCALCEKPEVCDYPDIYSGYEGALRCL 244 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 28.7 bits (61), Expect = 0.051 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 117 NNCRIVECQCSCECPRLFSGYTGVLDCV 200 N C + E C+ P ++SGY G L C+ Sbjct: 217 NMCALCEKPEVCDYPDIYSGYEGALRCL 244 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 25.8 bits (54), Expect = 0.36 Identities = 10/35 (28%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 238 LCNADLYCCHRGGTQSSTPVYPEKSRG-HSQLHWH 137 LCN Y ++G +S+ ++P+++ G H W+ Sbjct: 153 LCNHIKYSTNKGNIRSAITIFPQRTDGKHDYRVWN 187 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 Query: 492 CMACC*MRSARLVCSATRSPCSCYR 566 C C + + CS T +PC +R Sbjct: 87 CNKCIGCSAEKFECSKTSNPCLPHR 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,828 Number of Sequences: 438 Number of extensions: 3129 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -