BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P15 (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.14c |dpb2||DNA polymerase epsilon catalytic subunit b Dp... 26 3.8 SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 25 6.7 SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosa... 25 6.7 >SPBP8B7.14c |dpb2||DNA polymerase epsilon catalytic subunit b Dpb2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 26.2 bits (55), Expect = 3.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 108 VTPPVIIPILANSAAPAETSDSDAASLK 191 VT P++IP+LAN P E S A ++ Sbjct: 86 VTRPLLIPVLANLNVPHEVRVSSLARVQ 113 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 393 WLFTDNKKNVTCIVVQFAAQLNVTYPKVAENVTSLAYVLVN 515 WL + N K V+C++ F +++ +P T + Y L+N Sbjct: 40 WLRSKNFK-VSCLLKHFNSKIINDHPLSGSCYTDIGYALIN 79 >SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.4 bits (53), Expect = 6.7 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 452 LSCELHNYTCDIFLVIR 402 LSC H+Y+ D+FL+IR Sbjct: 243 LSCWDHHYSDDVFLLIR 259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,870,434 Number of Sequences: 5004 Number of extensions: 29661 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -