BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P10 (470 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 1.3 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 2.3 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 3.1 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 4.1 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.0 bits (52), Expect = 1.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 293 KHRYQVKGKHQLLALVEHHDK 355 K R V+ KH LLA +EH ++ Sbjct: 1620 KGRLYVRQKHDLLAAIEHSNR 1640 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 2.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 418 RYHTRGCILVLKCNSPRISQLFVVMFHQC*ELMFALDLVTVFG 290 R +RG I K + +++ + V++F C DL+ VFG Sbjct: 438 RASSRGIIPRAKVKTVKMTIVIVIVFVLCWSPYIIFDLLQVFG 480 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.8 bits (49), Expect = 3.1 Identities = 11/45 (24%), Positives = 25/45 (55%) Frame = +2 Query: 311 KGKHQLLALVEHHDKQLRNARRIAFQHQNTTPCVVAIIKLTKTRQ 445 K + + L++ H+K+L + R Q + +V+ ++ T+T+Q Sbjct: 681 KKRSEYSQLIQEHEKELADFRAELKQTEANINSIVSEMQKTETKQ 725 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 4.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 272 IKCSSQTKHRYQVKGKHQLLALVEHH 349 IK +T+H +V G++ LL HH Sbjct: 106 IKSQHETRHGDEVHGQYSLLDSDGHH 131 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,397 Number of Sequences: 2352 Number of extensions: 10919 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -