BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P05 (550 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 24 1.0 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 5.4 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 21 9.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 9.4 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 9.4 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.8 bits (49), Expect = 1.0 Identities = 14/48 (29%), Positives = 18/48 (37%) Frame = -2 Query: 546 PALRRPPYTRRSARS*GSIGPNNGARGLTNGARGPTNGAIGTTNVARG 403 P R PPY R R+ G GP G P++ + T G Sbjct: 79 PYPRFPPYDRMDIRAAGYYGPQQQMDGQEYRPDSPSSMHMANTAAPNG 126 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 140 WCTSTRLLLKLEKRD 184 W T +LLKLE +D Sbjct: 95 WSTLFEILLKLESKD 109 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 514 PTRIWRAAERR 546 PT WR AE+R Sbjct: 550 PTNTWREAEQR 560 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = +2 Query: 206 RVFLFFFF*SENISKLKKLVHLAKYREH 289 +++ F+ +SK +L+H + EH Sbjct: 1026 KIYFFYLVKFYKVSKSGELIHKIETNEH 1053 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/28 (25%), Positives = 15/28 (53%) Frame = +2 Query: 206 RVFLFFFF*SENISKLKKLVHLAKYREH 289 +++ F+ +SK +L+H + EH Sbjct: 307 KIYFFYLVKFYKVSKSGELIHKIETNEH 334 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,189 Number of Sequences: 336 Number of extensions: 2299 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -