BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P03 (444 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0471 + 21130839-21130869,21131013-21131127,21132228-211323... 103 5e-23 01_01_1184 - 9430623-9430658,9430945-9431013,9431104-9431270,943... 30 0.73 01_06_1183 - 35176780-35177266,35179631-35181093 29 1.3 12_01_0988 - 10039187-10039243,10039356-10039649,10039838-100402... 29 1.7 04_03_0691 - 18756812-18756883,18757453-18757590,18758017-187583... 29 2.2 03_05_0432 - 24231984-24233048,24233391-24235160,24235261-242365... 28 2.9 01_01_0473 - 3478660-3480338,3480507-3480609 28 3.9 10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721,160... 27 5.1 08_02_0517 - 18087769-18088026,18088148-18088519 27 5.1 02_05_0881 + 32473208-32473575,32473742-32473826,32473991-324740... 27 9.0 >06_03_0471 + 21130839-21130869,21131013-21131127,21132228-21132309, 21132444-21132648,21133237-21133296,21133420-21133472, 21133589-21133711,21133844-21133913,21134012-21134090, 21134172-21134253,21134272-21134310 Length = 312 Score = 103 bits (248), Expect = 5e-23 Identities = 52/119 (43%), Positives = 72/119 (60%), Gaps = 3/119 (2%) Frame = +1 Query: 97 AFRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDL 276 AFR+Y + K V + Y H N T DFV+ + + + + + I + + LN+ Sbjct: 47 AFRNYEAESER--KETVEEFYRVNHINQTYDFVRRMREEYGRVDKTEMGIWECIELLNEF 104 Query: 277 VDESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVM---AFYEEPQWCV 444 +D+SDPD ++P I H QTAE IR+D PD+DW HL GLIHDLGKV+ +F E PQW V Sbjct: 105 IDDSDPDLDMPQIEHLLQTAEAIRKDFPDEDWLHLTGLIHDLGKVLLHPSFGELPQWSV 163 >01_01_1184 - 9430623-9430658,9430945-9431013,9431104-9431270, 9431596-9431693,9431790-9431929,9432911-9433120, 9434314-9434832 Length = 412 Score = 30.3 bits (65), Expect = 0.73 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = -1 Query: 141 HLDRIVFIHRVITERFQRFVLVFLLWSE 58 HLDR +++H+V+T R +++ L++SE Sbjct: 164 HLDRYLYVHKVLTCRLGSALMLSLIYSE 191 >01_06_1183 - 35176780-35177266,35179631-35181093 Length = 649 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 402 EIVNESNEVEPIIVRMVLTDPLRCLESVHNVRQ 304 EIV E +E I+V + + DP C E + ++ Q Sbjct: 188 EIVPERERLEEILVEVGINDPASCSEEIESLEQ 220 >12_01_0988 - 10039187-10039243,10039356-10039649,10039838-10040202, 10042916-10042931 Length = 243 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 202 KMDNWLKFNHFKST-IKDALIK--LNDLVDESDPDTNLPNIVHAFQTAERIREDHPDDDW 372 K+ NW K N +KDA+ + ++D +D T L NI +F+ A + ++W Sbjct: 72 KLANWEKSNRMCLIYVKDAISPEVIGGIIDSNDIKTYLANIEESFEFAPEAHANTLKEEW 131 >04_03_0691 - 18756812-18756883,18757453-18757590,18758017-18758308, 18758485-18758648,18759159-18759434,18759512-18759718, 18760303-18760475,18761978-18762139,18762561-18762720 Length = 547 Score = 28.7 bits (61), Expect = 2.2 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 369 IIVRMV-LTDPLRCLESVHNVRQVSVRI-GFIDQIVQLDESILYCR 238 I+VRM PL+CLE+V +Q R GF + ++ ++CR Sbjct: 499 ILVRMPKCVHPLKCLETVTREKQKQTRTPGFCSNQFSVSKTWIFCR 544 >03_05_0432 - 24231984-24233048,24233391-24235160,24235261-24236582, 24236668-24237013 Length = 1500 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = -1 Query: 315 NVRQVSVRIGFIDQIVQLDESILYCRLEVVEFQPIIHFTLDEINC 181 N ++++ IG + +++ L+E Y L+ ++ I+H L EINC Sbjct: 693 NNQKLTKCIGSVLKVLHLEEK--YESLDQMKLDSIVHLILHEINC 735 >01_01_0473 - 3478660-3480338,3480507-3480609 Length = 593 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 Query: 220 KFNHFKSTIKDALIKLNDLVDESDPD 297 K++H KST++ +IKL D+V + D Sbjct: 264 KYSHDKSTLETEIIKLQDIVKNFEGD 289 >10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721, 1604587-1604651,1604704-1604746,1605086-1605128, 1605874-1605955,1606270-1606464,1606567-1606721, 1611207-1611435,1611538-1611693,1612539-1613476, 1614946-1614967 Length = 1078 Score = 27.5 bits (58), Expect = 5.1 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +1 Query: 79 EDKPLEAFRDYTVDENDPIKMRVRKTYYDMHTNMT-VDFVKGKMDNWLKFNHFKSTI 246 ED PLE D++DP+ RV K + D + MT +++ D+W + F+ + Sbjct: 530 EDDPLEVTCLEDDDDDDPLVDRVEKFFRD--SGMTSLEYPAAFYDSWRVLSEFQDLL 584 >08_02_0517 - 18087769-18088026,18088148-18088519 Length = 209 Score = 27.5 bits (58), Expect = 5.1 Identities = 13/56 (23%), Positives = 29/56 (51%) Frame = +1 Query: 196 KGKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNIVHAFQTAERIREDHPD 363 +G +D ++ ++H IK+ K+ + + P+ V +F+ ER+ E+ P+ Sbjct: 109 EGPLDEFIYYHHEMVLIKEFPGKVILFCEVAPPEGGETPFVPSFRVTERVMEEFPE 164 >02_05_0881 + 32473208-32473575,32473742-32473826,32473991-32474053, 32474199-32474241,32474737-32474796,32475001-32475301, 32475554-32475668,32476168-32476272,32476338-32476517 Length = 439 Score = 26.6 bits (56), Expect = 9.0 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 346 REDHPDDDWFHLIGLIHDLGK 408 R +PDD+WF+ + + + +G+ Sbjct: 372 RIPYPDDNWFYQVSVFYQIGR 392 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,786,249 Number of Sequences: 37544 Number of extensions: 260105 Number of successful extensions: 656 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -