BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_P02 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) 30 1.6 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 29 2.9 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_29132| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_54844| Best HMM Match : Microvir_J (HMM E-Value=1.7) 27 8.8 SB_20301| Best HMM Match : Drf_FH1 (HMM E-Value=0.43) 27 8.8 SB_1018| Best HMM Match : adh_short (HMM E-Value=2.1e-33) 27 8.8 >SB_24384| Best HMM Match : I-set (HMM E-Value=4.3e-31) Length = 1399 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Frame = +1 Query: 235 SGKTPEDKMAGILLEAR-QGDKIV---GTWTVSPDDTFSQPLNCGEPNNAVTHKMHWPRI 402 SGKT D G+ L+A+ +G + G T SP + F L+ + N A H P Sbjct: 60 SGKTTRDGEYGVYLKAKCEGYTRIYCHGMNTDSPQE-FISLLSGSQRNYAYIHDYMQPEW 118 Query: 403 RRTDCFFTPG 432 +T+C PG Sbjct: 119 NKTECSLIPG 128 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 187 TAVSSVKAGHSIDVVISGKTPEDK 258 T+V +K G I+VVIS K PED+ Sbjct: 72 TSVEQMKEGTVIEVVISAKVPEDE 95 >SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1980 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = +3 Query: 126 RHDPRARC*CSDSTSALHHHYSCQLGKSWSFH*RGYQRQNTRRQNGRH 269 RHD C S ++ + C + W GY+RQ TR +H Sbjct: 1789 RHDKGVECLPSCTSDGSYEELQCIRDECWCVDKYGYERQATRMIGRKH 1836 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 316 RSKCRRSC-HPDELPGGCRPFC 254 R++C R C +P+ +PG C P C Sbjct: 250 RTECSRDCPNPEPIPGQCCPIC 271 >SB_29132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 372 GVIWFTTVE-GLREGIIGAYGPSADDLVTLTSFQEDA 265 GV WF ++ +R I GA GP+ + T EDA Sbjct: 285 GVSWFALLKVNIRSSIAGAGGPAMEAQTEFTKLLEDA 321 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 143 TLLMFRQYQRLTPSLQLSAR*KLVIPLTWLSAAKHPKTKWPASSW 277 +LL R Q P S V + WL+ + P++ WP S W Sbjct: 1582 SLLEVRNSQNCDPIFVASVFVATVARVAWLTLSLWPRSLWPWSFW 1626 >SB_54844| Best HMM Match : Microvir_J (HMM E-Value=1.7) Length = 189 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +2 Query: 443 GLRRRRCVQGHHCQELRRLLGRNRISPRKGSKSLNH 550 GL RR+C+Q QE+R + S + +++++H Sbjct: 52 GLERRKCLQSFKSQEIRVFGSKGANSSKDETENIDH 87 >SB_20301| Best HMM Match : Drf_FH1 (HMM E-Value=0.43) Length = 346 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/52 (26%), Positives = 22/52 (42%) Frame = +1 Query: 97 PTGAPPSACFDMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTPE 252 P G P C + PG+ DV +PA Y + G + ++ G P+ Sbjct: 274 PPGYGPDVCI-IPPGYGPDVYIIPADYGPDVCIIPPGYGPDVCIIPPGYGPD 324 >SB_1018| Best HMM Match : adh_short (HMM E-Value=2.1e-33) Length = 717 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 256 KMAGILL-EARQGDKIVGTWTV---SPDD-TFSQPLNCGEPNNAVT 378 K+ GI L ++G K+V +WTV +P F+ P G+P+ +T Sbjct: 625 KVKGIFLWHVKKGGKVVSSWTVDLKTPGGAVFTGPPKGGKPDTTIT 670 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,398,281 Number of Sequences: 59808 Number of extensions: 486546 Number of successful extensions: 1521 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1519 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -