BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O18 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 23 1.6 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 3.6 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.3 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 8.3 AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esteras... 21 8.3 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 23.4 bits (48), Expect = 1.6 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = +3 Query: 297 TASHSTSNVSHTRCK-GGNCRH-GHRFRTRSR*NIRV*QRTDNDNRSRCEQCP 449 T S S+ HT CK GG C+ G F R + + + NR R P Sbjct: 140 TCSLKDSHCDHTTCKNGGTCQDLGKTFMCRCPPDWEGTTLSQSPNRRRASSNP 192 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -3 Query: 361 PCRQFPPLHLVCDTLLVLCEAVPLPM 284 P PP +C+ L L + PLP+ Sbjct: 160 PGPALPPAGFLCNNYLPLPQVPPLPL 185 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -1 Query: 192 LVILHPCQSLCEEPFRSVDARRLPRSSE 109 +V++ S+C E ++S ++ PRSS+ Sbjct: 217 VVLIFTYTSICIEIWQSSESSLRPRSSQ 244 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = -2 Query: 461 VSTERTLFTS*PVIVISSLLNPNVSSTACAKAVSMSTISPF 339 + + LF P+I+I P + +A + +SPF Sbjct: 1 LQVDMQLFVLSPIILIPLFRWPKIGLSALGFLIIAGCVSPF 41 >AJ850293-1|CAH64513.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 205 CHVQPVAEKLEMRKV 249 CH +P+AE + KV Sbjct: 13 CHAEPIAELPNLGKV 27 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,409 Number of Sequences: 336 Number of extensions: 3281 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -