BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0001_O18 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 2.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 2.4 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 23 2.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 2.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.3 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.0 bits (47), Expect = 2.4 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +3 Query: 30 RLWSRTQPLLTCSYTIETFEE-KVRIPFH---WISANGAHRPTGMVPHTDS 170 R++ L+ + + TF + K+ IP WI A HR + + P+ DS Sbjct: 365 RMYPPASILMRKAISDYTFNDTKITIPKEMKIWIPAFAIHRDSAIYPNPDS 415 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 521 ILDSAYFFSTANHRTNVSALVSTE 450 ++DS F T N+R + +STE Sbjct: 146 LMDSDVIFVTINYRLGILGFLSTE 169 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 521 ILDSAYFFSTANHRTNVSALVSTE 450 ++DS F T N+R + +STE Sbjct: 17 LMDSDVIFVTINYRLGILGFLSTE 40 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 521 ILDSAYFFSTANHRTNVSALVSTE 450 ++DS F T N+R + +STE Sbjct: 146 LMDSDVIFVTINYRLGILGFLSTE 169 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 110 SLDLGKRRASTDRNGSSHRL 169 +LDLG+ R S NGS L Sbjct: 458 TLDLGENRISNFYNGSFRNL 477 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,400 Number of Sequences: 438 Number of extensions: 3885 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -